resource-agents-3.9.5-46.el6$>t ZW-L>@?d  P" Nf    l 4& 58ӷBӿGHּI٤X`YlZڌ[ڐ\ژ]݀^bd8e=f@lBtXu@v(whxPy8jCresource-agents3.9.546.el6Open Source HA Reusable Cluster Resource ScriptsA set of scripts to interface with several services to operate in a High Availability environment for both Pacemaker and rgmanager service managers.Xc1bm.rdu2.centos.orgICentOSGPLv2+ and LGPLv2+CentOS BuildSystem System Environment/Basehttp://to.be.defined.com/linuxi686ccs_update_schema > /dev/null 2>&1 ||:("!U KMG# ##"a })u/F>%,)[U - 3.9.5-46Oyvind Albrigtsen - 3.9.5-43Oyvind Albrigtsen - 3.9.5-42Oyvind Albrigtsen - 3.9.5-41Oyvind Albrigtsen - 3.9.5-40Oyvind Albrigtsen - 3.9.5-38Oyvind Albrigtsen - 3.9.5-37Oyvind Albrigtsen - 3.9.5-36Oyvind Albrigtsen - 3.9.5-35Oyvind Albrigtsen - 3.9.5-34Oyvind Albrigtsen - 3.9.5-32Jan Pokorny - 3.9.5-31Oyvind Albrigtsen - 3.9.5-30Oyvind Albrigtsen - 3.9.5-29Oyvind Albrigtsen - 3.9.5-28Oyvind Albrigtsen - 3.9.5-27Oyvind Albrigtsen - 3.9.5-26Fabio M. Di Nitto - 3.9.5-25David Vossel - 3.9.5-24David Vossel - 3.9.5-23David Vossel - 3.9.5-22David Vossel - 3.9.5-21David Vossel - 3.9.5-20David Vossel - 3.9.5-19David Vossel - 3.9.5-18David Vossel - 3.9.5-17David Vossel - 3.9.5-16David Vossel - 3.9.5-15David Vossel - 3.9.5-14David Vossel - 3.9.5-13David Vossel - 3.9.5-12David Vossel - 3.9.5-11David Vossel - 3.9.5-10David Vossel - 3.9.5-9David Vossel - 3.9.5-8David Vossel - 3.9.5-7David Vossel - 3.9.5-6David Vossel - 3.9.5-5David Vossel - 3.9.5-4David Vossel - 3.9.5-3Fabio M. Di Nitto - 3.9.5-2David Vossel - 3.9.5-1David Vossel - 3.9.2-49David Vossel - 3.9.2-48David Vossel - 3.9.2-47David Vossel - 3.9.2-46David Vossel - 3.9.2-45David Vossel - 3.9.2-44David Vossel - 3.9.2-43David Vossel - 3.9.2-42David Vossel - 3.9.2-41Fabio M. Di Nitto - 3.9.2-40.3Fabio M. Di Nitto - 3.9.2-40.2David Vossel - 3.9.2-40David Vossel - 3.9.2-39David Vossel - 3.9.2-38David Vossel - 3.9.2-37David Vossel - 3.9.2-36David Vossel - 3.9.2-35David Vossel - 3.9.2-34Ryan McCabe - 3.9.2-33Ryan McCabe - 3.9.2-32David Vossel - 3.9.2-31David Vossel - 3.9.2-30David Vossel - 3.9.2-29David Vossel - 3.9.2-28David Vossel - 3.9.2-27David Vossel - 3.9.2-26David Vossel - 3.9.2-25David Vossel - 3.9.2-24Ryan McCabe - 3.9.2-23Ryan McCabe - 3.9.2-22Chris Feist - 3.9.2-21Chris Feist - 3.9.2-20Chris Feist - 3.9.2-19Chris Feist - 3.9.2-18Chris Feist - 3.9.2-17Chris Feist - 3.9.2-16Chris Feist - 3.9.2-15Chris Feist - 3.9.2-14Fabio M. Di Nitto - 3.9.2-13Chris Feist - 3.9.2-12Chris Feist - 3.9.2-11Chris Feist - 3.9.2-10Chris Feist - 3.9.2-9Chris Feist - 3.9.2-8Chris Feist - 3.9.2-7Chris Feist - 3.9.2-4Chris Feist - 3.9.2-3Chris Feist - 3.9.2-2Fabio M. Di Nitto - 3.9.2-1Chris Feist - 3.9.1-2Fabio M. Di Nitto - 3.0.12.1-1Lon Hohberger - Version: 3.0.12-22Lon Hohberger - Version: 3.0.12-21Fabio M. Di Nitto - 3.0.12-20Lon Hohberger - 3.0.12-19Marek Grac - 3.0.12-18Marek Grac - 3.0.12-17Lon Hohberger - Version: 3.0.12-16Marek Grac - 3.0.12-15Lon Hohberger - 3.0.12-14Lon Hohberger - 3.0.12-13Marek Grac - 3.0.12-12Lon Hohberger - 3.0.12-10Lon Hohberger - 3.0.12-9Lon Hohberger - 3.0.12-8Lon Hohberger - 3.0.12-7Lon Hohberger - 3.0.12-6Fabio M. Di Nitto - 3.0.12-5Andrew Beekhof - 3.0.12-4Andrew Beekhof - 3.0.12-3Fabio M. Di Nitto - 3.0.12-2Fabio M. Di Nitto - 3.0.12-1Fabio M. Di Nitto - 3.0.9-1Fabio M. Di Nitto - 3.0.7-5Marek Grac - 3.0.7-4Marek Grac - 3.0.7-3Fabio M. Di Nitto - 3.0.7-2Fabio M. Di Nitto - 3.0.7-1Andrew Beekhof - 3.0.6-2Fabio M. Di Nitto - 3.0.6-1Andrew Beekhof - 3.0.5-2Fabio M. Di Nitto - 3.0.5-1Andrew Beekhof - 3.0.4-2Fabio M. Di Nitto - 3.0.4-1Andrew Beekhof - 3.0.3-3Fabio M. Di Nitto - 3.0.3-1Fabio M. Di Nitto - 3.0.1-1Andrew Beekhof - 3.0.0-16Ville Skyttä - 3.0.0-15Fabio M. Di Nitto - 3.0.0-14Fedora Release Engineering - 3.0.0-13Fabio M. Di Nitto - 3.0.0-12Fabio M. Di Nitto - 3.0.0-11.rc4Fabio M. Di Nitto - 3.0.0-10.rc3Fabio M. Di Nitto - 3.0.0-9.rc2Fabio M. Di Nitto - 3.0.0-8.rc1Fabio M. Di Nitto - 3.0.0-7.beta1Fabio M. Di Nitto - 3.0.0-6.alpha7Fabio M. Di Nitto - 3.0.0-5.alpha6Fabio M. Di Nitto - 3.0.0-4.alpha5Fabio M. Di Nitto - 3.0.0-3.alpha5Fabio M. Di Nitto - 3.0.0-2.alpha4Fabio M. Di Nitto - 3.0.0-1.alpha4Fabio M. Di Nitto - 3.0.0-1.alpha3- LVM: fix for "partial vg activates when partial_activation=false" Resolves: rhbz#1332909- oracle: fix unable to start because of ORA-01081 Resolves: rhbz#1318240- exportfs: fix for IPv6 addresses Resolves: rhbz#1406843- portblock: create tickle_dir if it doesnt exist Resolves: rhbz#1327662- SAPHana/SAPHanaTopology: update to version 0.152.17 - Add netstat dependency Resolves: rhbz#1381891 Resolves: rhbz#1395594- Delay: change startdelay default to avoid timeout before starting Resolves: rhbz#1386187- lvm.sh: fix status clustered to check specific volume - netfs.sh: move defaults to metadata - nfsserver: use rpcpipefs_dir variable Resolves: rhbz#1320520 Resolves: rhbz#1286291 Resolves: rhbz#1382036- SAPDatabase: fix process count for SUSER - oracle: use monprofile parameter - send_arp: fix buffer overflow on infiniband devices - mysql: use replication_port variable - oracle: inform user that monprofile monuser must start with C## for container databases Resolves: rhbz#1260710 Resolves: rhbz#1358892 Resolves: rhbz#1351717 Resolves: rhbz#1337146 Resolves: rhbz#1374655- tickle_tcp: fix "Failed to open raw socket (Invalid argument)" issue Resolves: rhbz#1327662- rgmanager: fix .clumanager/statd ownership in fs.sh and clusterfs.sh Resolves: rhbz#1311963- Add portblock resource agent for Pacemaker - Add Oracle Data Guard resource agent for rgmanager Resolves: rhbz#1302545 Resolves: rhbz#1086838- Fix up for wrongly generated RNG schema for cluster configuration wrt. "action" tag Related: rhbz#1272587- Add migrate_options parameter to vm.sh Resolves: rhbz#1285921- Set VirtualDomain migrate_options default Resolves: rhbz#1286650- Use IPv6 DAD for collision detection in IPaddr2 - Add RAID segment type support for HA LVM - Fix Tomcat SELinux failed in enforcing mode - Add migrate_options parameter to VirtualDomain - Remove not-working tmpfs "support" from fs.sh - Fix tmpfile leak in mysql resource agent Resolves: rhbz#1276698 Resolves: rhbz#1266173 Resolves: rhbz#1280319 Resolves: rhbz#1286650 Resolves: rhbz#1024505 Resolves: rhbz#1292054- SAP HANA add Multiple Components One System (MCOS) support - sap_redhat_cluster_connector add support for "-" in hostnames Resolves: rhbz#1200903 Resolves: rhbz#1269897- Match exact Oracle SID to avoid waiting for 90 seconds and killing other databases if their names include the name of the database you're trying to stop - Use DAD to check for address collision instead of ping for IPv6 in rgmanager - MySQL wait up to "startup_wait" seconds for mysqld to create PID - Handle failure state during stop in orainstance.sh - Add Oracle resource agents for Pacemaker Resolves: rhbz#1200639 Resolves: rhbz#1191247 Resolves: rhbz#1207285 Resolves: rhbz#1234777 Resolves: rhbz#1070479- SAP Hana update to address several bugs Resolves: rhbz#1245730- Update addresses bug fixes for SAP Hana agents. Resolves: rhbz#1168251- Update addresses bug fixes for SAP Hana agents. Resolves: rhbz#1168251- Update SAP Hana agents. Resolves: rhbz#1168251- Place SAP Hana agents in sap-hana subpackage Resolves: rhbz#1168251- Preserves nfs sysconfig when using nfsserver agent. Resolves: rhbz#1179412- Introduce the nginx agent. Resolves: rhbz#1150655- SAP Hana agents. Resolves: rhbz#1168251- Fixes rgmanager lvm agent's ability to exclusively activate volume groups on nodes with aliases Resolves: rhbz#1085109- Fixes unreliable detection of nic device in IPaddr2 - Fix fs-lib.sh regression in is_alive write test failure detection - Fix properly handle mysql when alternate user is specified. Resolves: rhbz#1181187 Resolves: rhbz#1183735 Resolves: rhbz#1183148- Prevent oracle agents from failing on non critical errors Resolves: rhbz#1151379- For lv_by_vg, only strip tag on stop if we are owner. - NFS custom port config options - Fixes typo preventing passing "noload" or "data=..." mount options - Fixes undefined variable warning in fs-lib - Fixes mysql not stopped if data fs unavailable - Fixes postgres agent not detected correct user group - Handle nfs path ending in '/' correctly Resolves: rhbz#1161727 Resolves: rhbz#1096376 Resolves: rhbz#1096990 Resolves: rhbz#1134960 Resolves: rhbz#1150702 Resolves: rhbz#1159018 Resolves: rhbz#1173128- ip.sh now sends unsolicited advertisement packet for ipv6 Resolves: rhbz#1159805- Properly search for oracldb processes in oracledb.sh stop operations. Resolves: rhbz#960186- Updates required, unique, and primary fields in bind-mount.sh metadata Resolves: rhbz#1094789- Fixes bind-mount.sh metadata function. Resolves: rhbz#1094789- When signalling pids accessing a mount_point to exit, make sure to only signal each pid once. Resolves: rhbz#1089004- Revert accidental modification of exportfs's unlock_on_stop option. - Add on/off as valid value for ip.sh monitor_link Resolves: rhbz#1091102 Resolves: rhbz#1039119- Update force_unmount=safe option so it does not process duplicate process ids. Resolves: rhbz#1095943- Remove db2 exclude entries from spec file. Resolves: rhbz#1059981- Add support for pacemaker db2 agent - Fix syntax error in nfsserver.sh - Updates pacemaker nfs server agents. Adds support for nfsnotify agent. Resolves: rhbz#1059981 Resolves: rhbz#1091102 Resolves: rhbz#974239- Introduce passing ocft test cases. Resolves: rhbz#1023606- Fix usage of findmnt in fs-lib.sh based rgmanager agents. - When executing force kill of processes using a mountpoint, take into account those processes accessing shared memory. - Add force_unount=safe option to avoid blocking Filesystem agent during the stop operation. - Do not fail during stop if oracle listener is already down. - Correctly detect oracledb and orainstanch.sh shutdown. - Remove unused patches left over from before patches were consolidated into the new source files. Resolves: rhbz#1038474 Resolves: rhbz#1089004 Resolves: rhbz#1095943 Resolves: rhbz#1047999 Resolves: rhbz#960186 Resolves: rhbz#993431- Build sap package only on x86_64 Resolves: rhbz#1031601- Package cleanup. This change is a no-op. The heartbeat agents were updated to the 3.9.5 upstream release in this package months ago. The release number is now being incremented to reflect this. Resolves: rhbz#993431- Add iSCSILogicalUnit to rhel supported agents. Resolves: rhbz#1075000- Configurable startup_wait timeout for rgmanager's postgres-8.sh resource-agent - Allow non rhel builds to included unsupported agents. - Add bind-mount.sh rgmanager resource-agent. - Add 'statdport' option to nfsserver resource. Resolves: rhbz#1035380 Resolves: rhbz#1069621 Resolves: rhbz#1094789 Resolves: rhbz#918315- Allow vm.sh to monitor kvm domains without requiring libvirtd - Adds 'no_kill' option to vm.sh to prevent force killing vm during stop operation after timeout expires. Resolves: rhbz#853698 Resolves: rhbz#1079039- Updates the ocf:heartbeat:tomcat agent so it can be used in rhel6 with Pacemaker. Resolves: rhbz#1022792- Fixes unintentional removal of patch in previous build- New 'httpd' option for rgmanager apache.sh agent that allows custom httpd binary path to be set. - Fixes issue with pending sm-notify processes preventing nfs-server instances from stopping. - Fixes issue reported by coverity. - Fixes syntax error in some log error messages in the LVM agent - Optimize fs-lib based agent's monitor operation - Allow monitoring of kvm based virtual machines using the VirtualDomain agent without requiring libvirtd. - Allows named to run as user other than root. Resolves: rhbz#952132 Resolves: rhbz#974239 Resolves: rhbz#999537 Resolves: rhbz#1022277 Resolves: rhbz#1023099 Resolves: rhbz#1054327 Resolves: rhbz#1067023Add sec=krb5 as a valid nfsclient mount option Resolves: rhbz1019931- High: fs-lib.sh: Fixes failure to unmount local fs when process runs with cwd inside fs mount. Resolves: rhbz#1051115- Add no_unmount functionality back into netfs.sh agent - Use crm_node instead of uname -n when referencing cluster nodes. - Adds Delay agent back into package. - Drops nginx rsyslog mysql-proxy tomcat and slapd agents. Resolves: rhbz#993329 Resolves: rhbz#1023340 Resolves: rhbz#1028421 Resolves: rhbz#1022793- Fix netfs mount detection Resolves: rhbz#1027410- Fix netnfs unmount self_fence integration in netfs.sh - Ship send_ua helper binary to allow IPaddr2 to manage IPv6 addresses Resolves: rhbz#1027410 Resolves: rhbz#1027412- Advertises self_fence option in netfs.sh agent Resolves rhbz#1014298- Fixes issue with mysql agent not being able to set transient attributes on local node correctly. Resolves: rhbz#989284- Removes usage of fuser -kvm from fs-lib.sh based agents. This resolves issue with fuser blocking netfs mounts. - tomcat-6.sh, Do not fail on stop if config validation fails. - tomcat-6.sh, Set tomcat usr correctly. Resolves: rhbz#981717 Resolves: rhbz#983273 Resolves: rhbz#1014298- Fixes lvm metadata corruption caused when activating by lv using tags. Resolves: rhbz#1009772- Disables LVM exclusive activation via clvmd as it is not supported. Resolves: rhbz#989284- Fixes invalid return statement in LVM retry clvmd activation - Adds ability to disable findmnt to avoid autofs complications for fs-util based rgmanager agents. Resolves: rhbz#974941 Resolves: rhbz#989284- Use correct default config for heartbeat apache agent Resolves: rhbz#989284- Add support for setting TNS_ADMIN Resolves: rhbz#917807- Med: oracledb.sh: Fix process name grep in exit_idle Resolves: rhbz#853220- Fixes lvm agent unncessarily removing PVs/LVs when some PVs in VG fail. Resolves: rhbz#884326- Add correct nfs server defaults. Resolves: rhbz#989284- Add run-time dependencies for heartbeat agents. Resolves: rhbz#989284- Merge upstream heartbeat agents in for Pacemaker support. Resolves: rhbz#989284- Add missing sap agents to sap subpackage Resolves: rhbz#922838- Add sap connector script - Create SAP subpackage Resolves: rhbz#922838- fast filesystem mounts - properly handle NFS v4 mounts - fix uppercase ipv6 addresses - named transfer source options - fix restart postgres - fix honor self fence option - fix mount log level - fix wrong selinux context for nfs directory Resolves: rhbz#919231 Resolves: rhbz#851188 Resolves: rhbz#895075 Resolves: rhbz#711586 Resolves: rhbz#871659 Resolves: rhbz#908457 Resolves: rhbz#948730 Resolves: rhbz#959520- Fix: lvm: detection of clusternode with lvm using tags. Resolves: rhbz#976443- Med: oracledb.sh: Set RESTART_RETRIES back to 0 Resolves: rhbz#670022- Clean up Oracle resource agents and add support for Oracle 11g Resolves: rhbz#670022- Fixed missing '$' in lvm_by_vg.sh script - Retry VG shutdown to cope with udev collisions - Resolves: rhbz#729812- Update the rgmanager SAPInstance agent so resource limits configured in /usr/sap/services are properly applied. - Resolves: rhbz#869695- Better error messages for the script resource have been added to aid debugging - Resolves: rhbz#773478- SAPInstance and sapdb.sh were re-synced to the latest upstream versions - Resolves: rhbz#834293- HA LVM is now able to properly shutdown when device failures cause LVs to go missing which allows the service to migrate to another machine - Resolves: rhbz#860981- Add support for 'volume group per service HA-LVM support for RAID logical volumes' - Resolves: rhbz#824153- Fixes issue with rgmanager not recognizing a mounted cifs share due to trailing slashes - Resolves: rhbz#848642- Fixed issue causing fs.sh to fail when a device is still mounted - Fixed random servie failures when starting multiple HA LVM services - Tomcat resource now uses the proper defaults - The pacemaker SAPInstance and SAPDatabase resources were updated to their latest version - Updated lvm resource agent to not produce errors when used with pacemaker - oracledb.sh script now properly checks the status of the Oracle database - HA-LVM now supports RAID logical volumes - ip.sh now properly assignes the ip address to the correct interface on hosts with multiple interfaces on the same network - Stopping a filesystem when a device doesn't exist no longer results in failure - Log output from the 'status' action from netfs is now properly logged - In HA LVM clusters using tags, changing the lvm.conf file is now possible - Using rg_test with HA LVM resources no longer results in a "too many arguments" error - Resolves: rhbz#728365 rhbz#714156 rhbz#853249 rhbz#843049 rhbz#817550 rhbz#729812 rhbz#839181 rhbz#824153 rhbz#822244 rhbz#860328 rhbz#847335 rhbz#834293- Add nfsrestart option to fs and clustefs agents as last resource to umount the filesystem - Resolves: rhbz#822053- Fix for LVM HA agent for service relocation after leg failure (we now properly remove tag). - Resolves: rhbz#772773- In LVM HA agent, remove missing PVs before attempting to remove the tag - Rgmanager now properly detects when clvmd is not running when using HA LVM - vm.sh now supports a 'tunnelled' option - Resource agent script now have common directory set properly - Fixed apache resource agent configuration with IPv6 - fs-lib.sh now will now properly work with all return codes of mount - netfs now allows you to have the same NFS export mounted in different locations - The timeout in rhev-check has been increased to 90 seconds - Resolves: rhbz#772773 rhbz#729481 rhbz#712174 rhbz#784357 rhbz#742859 rhbz#728086 rhbz#799998 rhbz#727546- Fix to prevent /dev/shm being filled up by ocf_log debug messages - NFS client resource are now recovered properly when they are missing in /var/lib/nfs/etab - Resolves: rhbz#797922 rhbz#749713- More SAPDatabase updates to fix SAP workloads - Allow rgmanager SAP resource agent to manage SAP Webdispatcher & TREX - Resolves: rhbz#726500 rhbz#746996- Update SAPDatabase to more closely match upstream - Resolves: rhbz#784209- Require server_name in ASEHAagent to be unique - Resolves: rhbz#711852- Create a link for the modified dtd for rgmanager - Fix ocf-tester so rgmanager agents requiring bash don't cause syntax errors - Resolves: rhbz#727643- Main rgmanager resource agents now use proper return codes for use with pacemaker. - NFS mounts now unmount faster when the network is lost. - Resolves: rhbz#678497 rhbz#727643- Postgres-8 resource agent now properly detects if postgresql was started - fs.sh resource agent now returns the proper response code when a device does not yet exist. - Resolves: rhbz#709400 rhbz#694816- Rebase package on top of new upstream * ship xsl and rng files required to build relaxng schema * drop local copy of sfex_init.8 * drop bz711852-Fix-ASEHAagent-to-allow-for-multiple-ASEHA-agents-on.patch included upstream - spec file update: add %post to generate new relaxng schema Resolves: rhbz#707127- Fix ASEHAagent to allow for multiple ASEHA agents - Resolves: rhbz#711852- Rebase package on top of new upstream: resource-agents: Improve LD_LIBRARY_PATH handling by SAP* resource-agents: Add resource type to logging oracledb.sh resource script should attempt a clean shutdown first resource-agent does not remove nfs service temp dirs when using nfslock=1 Listen line in generated httpd.conf incorrect Include rhev-check upstream - spec file update: * drop all patches * resync with upstream spec file. See top section for local deltas Resolves: rhbz#707127, rhbz#705763, rhbz#667217 - Move rgmanager S/Lang from resource-agents to rgmanager: * Add versioned Conflicts on rgmanager to avoid file conflicts Resolves: rhbz#693518- resource-agents: Fix nfs mount contexts (fix_nfs_mount_contexts.patch) Resolves: rhbz#635828- Mirror dev failure in HA LVM can cause service failur (fix_bug_683213_mirror_dev_failure_in_ha_lvm_can_cause_service_failure.patch) Resolves: rhbz#683213- resource-agents: fs-lib: fix do_monitor device mapping (fs_lib_fix_do_monitor_device_mapping.patch) Resolves: rhbz#669832- resource-agents: Add multi-instance Oracle database agents (add_multi_instance_oracle_database_agents.patch) Resolves: rhbz#629275 - resource-agents: Stop using '-' as 1st char of log messages (stop_using_as_1st_char_of_log_messages.patch) Resolves: rhbz#633856 - resource-agents: Use literal quotes for tr calls (use_literal_quotes_for_tr_calls.patch) Resolves: rhbz#639252 - resource-agents: Fix migrateuriopt setting (fix_migrateuriopt_setting.patch) Resolves: rhbz#660337 - resource-agents: Support convalesce w/ central_processing (support_convalesce_w_central_processing.patch) rgmanager: Add failure tolerances to resources.rng (add_failure_tolerances_to_resources_rng.patch) Resolves: rhbz#674710- Disable updates to static routes by RHCS IP tooling (resource-agents-Add-option-disable_rdisc-to-ip.sh.patch) Resolves: rhbz#621538- fix resource agent for named (resource-agents-fix-resource-agent-for-named.patch) Resolves: rhbz#648897- resource-agents: fix utility to obtain data from ccs_tool (fix_utility_to_obtain_data_from_ccs_tool.patch) Resolves: rhbz#631943- postgresql RA does not work correctly with netmask (psql_does_not_work_correctly_with_netmask.patch) Resolves: rhbz#614457- resource-agents: Drop tomcat-5 from build (drop_tomcat_5_from_build.patch) Resolves: rhbz#593721- Allow other values for "yes" in fs-lib when unmounting file systems (fs-lib_allow_other_values_for_yes.patch) Resolves: rhbz#614421- postgres RA will fail to stop gracefully if there is active client connected (sigquit_if_sigterm_was_not_fast_enough.patch) Resolves: rhbz#612165 - new RA for tomcat6 (resource_agent_tomcat-6.patch) (tomcat-6_change_build_system.patch) Resolves: rhbz#593721- Fix changelog for 3.0.12-9 date - Add RHEVM status program (add_rhevm_status_program.patch) Resolves: rhbz#609497- Add NFSv4 server support (add_nfsv4_support.patch) (install_nfsv4_agent.patch) Resolves: rhbz#595547 - Fix migration mapping behavior (fix_migration_mapping_behavior.patch) Resolves: rhbz#596918- Make fs-lib resolve links before checking for block devices (fix_incorrect_link_resolution_in_fs_lib.patch) Resolves: rhbz#609579- Make vm.sh honor start and stop timeouts (Make_vm.sh_use_stop_start_timeouts.patch) Resolves: rhbz#606754- Add missing documentation for resource agents (add_missing_resource_docs.patch) - Clean up recursion in scheman output and documentation (clean_up_recursion_and_documentation.patch) Resolves: rhbz#606470- Fix incorrect default for VM.sh agent (resolve_incorrect_default_for_vm_agent.patch) Resolves: rhbz#599643- Add missing man pages (Add Source2: ocf-tester.8 and Source3: sfex_init.8) Resolves: rhbz#594332- Do not package ldirectord on RHEL Resolves: rhbz#577264- Drop Requires on xfsprogs since package moved to another channel Resolves: rhbz#593433 - Fix HALVM: lvm agent incorrectly reports vg is in volume_list (halvm_lvm_agent_incorrectly_reports_vg_in_volume_list.patch) Resolves: rhvz#593108- Rebase on top of new upstream bug fix only release: * drop all bug fix patches. * refresh patches with official SHA1 git commits from RHEL6 upstream branch: - drop_support_for_drbd_and_smb.patch * Addresses the follwing issues: from 3.0.12 release: Resolves: rhbz#582754, rhbz#582753, rhbz#585217, rhbz#583789 * Rebase: Resolves: rhbz#582353 - Stop build on ppc and ppc64. Resolves: rhbz#590997 - Switch to file based Requires. Also address several other problems related to missing runtime components in different agents. With the current Requires: set, we guarantee all basic functionalities out of the box for lvm/fs/clusterfs/netfs/networking. Resolves: rhbz#584800 - New pacemaker agents upstream release * Patched build process to correctly generate ldirectord man page + High: pgsql: properly implement pghost parameter + High: RA: mysql: fix syntax error + High: SAPInstance RA: do not rely on op target rc when monitoring clones (lf#2371) + High: set the HA_RSCTMP directory to /var/run/resource-agents (lf#2378) + High: RA: vmware: fix set_environment() invocation (LF 2342) + High: RA: vmware: update to version 0.2 + Medium: IPaddr/IPaddr2: add a description of the assumption in meta-data + Medium: IPaddr: return the correct code if interface delete failed + Medium: nfsserver: rpc.statd as the notify cmd does not work with -v (thanks to Carl Lewis) + Medium: oracle: reduce output from sqlplus to the last line for queries (bnc#567815) + Medium: pgsql: implement "config" parameter + Medium: RA: iSCSITarget: follow changed IET access policy + Medium: Filesystem: prefer /proc/mounts to /etc/mtab for non-bind mounts (lf#2388) + Medium: IPaddr2: don't bring the interface down on stop (thanks to Lars Ellenberg) + Medium: IPsrcaddr: modify the interface route (lf#2367) + Medium: ldirectord: Allow multiple email addresses (LF 2168) + Medium: ldirectord: fix setting defaults for configfile and ldirectord (lf#2328) + Medium: meta-data: improve timeouts in most resource agents + Medium: nfsserver: use default values (lf#2321) + Medium: ocf-shellfuncs: don't log but print to stderr if connected to a terminal + Medium: ocf-shellfuncs: don't output to stderr if using syslog + Medium: oracle/oralsnr: improve exit codes if the environment isn't valid + Medium: RA: iSCSILogicalUnit: fix monitor for STGT + Medium: RA: make sure that OCF_RESKEY_CRM_meta_interval is always defined (LF 2284) + Medium: RA: ManageRAID: require bash + Medium: RA: ManageRAID: require bash + Medium: RA: VirtualDomain: bail out early if config file can't be read during probe (Novell 593988) + Medium: RA: VirtualDomain: fix incorrect use of __OCF_ACTION + Medium: RA: VirtualDomain: improve error messages + Medium: RA: VirtualDomain: spin on define until we definitely have a domain name + Medium: Route: add route table parameter (lf#2335) + Medium: sfex: don't use pid file (lf#2363,bnc#585416) + Medium: sfex: exit with success on stop if sfex has never been started (bnc#585416)- new upstream release Resolves: rhbz#569959 - spec file update: * update spec file copyright date * use bz2 tarball- Resolves: rhbz#568010 - Do not build resource-agents on s390 and s390x.- Checksum error occurs on HA-LVM - status on clusterfs "gfs" returned 1 (generic error) - Resolves rhbz#563555 rhbz#558664- resource-agents can't be used by Pacemaker - Resolves: rhbz#566176- Drop support for drbd and smb (PM-drop-support-for-drbd-and-smb-resource-agents.patch) - Explicitly list python as BuildRequires- New rgmanager resource agents upstream release- Update Pacameker agents to upstream version: c76b4a6eb576 + High: RA: VirtualDomain: fix forceful stop (LF 2283) + High: apache: monitor operation of depth 10 for web applications (LF 2234) + Medium: IPaddr2: CLUSTERIP/iptables rule not always inserted on failed monitor (LF 2281) + Medium: RA: Route: improve validate (LF 2232) + Medium: mark obsolete RAs as deprecated (LF 2244) + Medium: mysql: escalate stop to KILL if regular shutdown doesn't work- New rgmanager resource agents upstream release - spec file update: * use global instead of define * use new Source0 url * use resource-agents macro more aggressively- Update Pacameker agents to upstream version: bc00c0b065d9 + High: RA: introduce OCF_FUNCTIONS_DIR, allow it to be overridden (LF2239) + High: doc: add man pages for all RAs (LF2237) + High: syslog-ng: new RA + High: vmware: make meta-data work and several cleanups (LF 2212) + Medium: .ocf-shellfuncs: add ocf_is_probe function + Medium: Dev: make RAs executable (LF2239) + Medium: IPv6addr: ifdef out the ip offset hack for libnet v1.1.4 (LF 2034) + Medium: add mercurial repository version information to .ocf-shellfuncs + Medium: build: add perl-MailTools runtime dependency to ldirectord package (LF 1469) + Medium: iSCSITarget, iSCSILogicalUnit: support LIO + Medium: nfsserver: use check_binary properly in validate (LF 2211) + Medium: nfsserver: validate should not check if nfs_shared_infodir exists (thanks to eelco@procolix.com) (LF 2219) + Medium: oracle/oralsnr: export variables properly + Medium: pgsql: remove the previous backup_label if it exists + Medium: postfix: fix double stop (thanks to Dinh N. Quoc) + RA: LVM: Make monitor operation quiet in logs (bnc#546353) + RA: Xen: Remove instance_attribute "allow_migrate" (bnc#539968) + ldirectord: OCF agent: overhaul- New rgmanager resource agents upstream release- Update Pacameker agents to upstream version: e2338892f59f + High: send_arp - turn on unsolicited mode for compatibilty with the libnet version's exit codes + High: Trap sigterm for compatibility with the libnet version of send_arp + Medium: Bug - lf#2147: IPaddr2: behave if the interface is down + Medium: IPv6addr: recognize network masks properly + Medium: RA: VirtualDomain: avoid needlessly invoking "virsh define"- New rgmanager resource agents upstream release- Update Pacameker agents to upstream version: 099c0e5d80db + Add the ha_parameter function back into .ocf-shellfuncs. + Bug bnc#534803 - Provide a default for MAILCMD + Fix use of undefined macro @HA_NOARCHDATAHBDIR@ + High (LF 2138): IPsrcaddr: replace 0/0 with proper ip prefix (thanks to Michael Ricordeau and Michael Schwartzkopff) + Import shellfuncs from heartbeat as badly written RAs use it + Medium (LF 2173): nfsserver: exit properly in nfsserver_validate + Medium: RA: Filesystem: implement monitor operation + Medium: RA: VirtualDomain: loop on status if libvirtd is unreachable + Medium: RA: VirtualDomain: loop on status if libvirtd is unreachable (addendum) + Medium: RA: iSCSILogicalUnit: use a 16-byte default SCSI ID + Medium: RA: iSCSITarget: be more persistent deleting targets on stop + Medium: RA: portblock: add per-IP filtering capability + Medium: mysql-proxy: log_level and keepalive parameters + Medium: oracle: drop spurious output from sqlplus + RA: Filesystem: allow configuring smbfs mounts as clones- New rgmanager resource agents upstream release- New rgmanager resource agents upstream release- Create an ldirectord package - Update Pacameker agents to upstream version: 2198dc90bec4 + Build: Import ldirectord. + Ensure HA_VARRUNDIR has a value to substitute + High: Add findif tool (mandatory for IPaddr/IPaddr2) + High: IPv6addr: new nic and cidr_netmask parameters + High: postfix: new resource agent + Include license information + Low (LF 2159): Squid: make the regexp match more precisely output of netstat + Low: configure: Fix package name. + Low: ldirectord: add dependency on $remote_fs. + Low: ldirectord: add mandatory required header to init script. + Medium (LF 2165): IPaddr2: remove all colons from the mac address before passing it to send_arp + Medium: VirtualDomain: destroy domain shortly before timeout expiry + Medium: shellfuncs: Make the mktemp wrappers work. + Remove references to Echo function + Remove references to heartbeat shellfuncs. + Remove useless path lookups + findif: actually include the right header. Simplify configure. + ldirectord: Remove superfluous configure artifact. + ocf-tester: Fix package reference and path to DTD.- Use bzipped upstream hg tarball.- Merge Pacemaker cluster resource agents: * Add Source1. * Drop noarch. We have real binaries now. * Update BuildRequires. * Update all relevant prep/build/install/files/description sections.- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- spec file updates: * Update copyright header * final release.. undefine alphatag- New upstream release.- New upstream release.- New upstream release + git94df30ca63e49afb1e8aeede65df8a3e5bcd0970- New upstream release. - Update BuildRoot usage to preferred versions/names- New upstream release.- New upstream release.- New upstream release.- Drop Conflicts with rgmanager.- New upstream release.- Add comments on how to build this package.- New upstream release. - Fix datadir/cluster directory ownership.- Initial packaging/bin/shheartbeat-resources "%&+./036?HMT]`cdehily|}~&/2567:;>KLMNOPQRUV[dgqrstuvwxyz{|}~3.9.53.9.5-46.el63.9.5-46.el6 3.9.5  ha.dshellfuncsheartbeatagent_config.hocflibheartbeatapache-conf.shfindif.shhttp-mon.shocf-binariesocf-directoriesocf-rarunocf-returncodesocf-shellfuncsora-common.shresource.dheartbeat.ocf-binaries.ocf-directories.ocf-returncodes.ocf-shellfuncsCTDBDelayDummyFilesystemIPaddrIPaddr2IPsrcaddrLVMMailToRouteSendArpSquidVirtualDomainXinetdapacheconntrackddb2dhcpdethmonitorexportfsiSCSILogicalUnitmysqlnamednfsnotifynfsservernginxoracleoralsnrpgsqlportblockpostfixrsyncdsymlinktomcatheartbeatfindifsend_arpsend_uatickle_tcpocftrhev-check.shclusterASEHAagent.shSAPDatabaseSAPInstanceapache.metadataapache.shbind-mount.shclusterfs.shfs.ship.shlvm.metadatalvm.shlvm_by_lv.shlvm_by_vg.shmysql.metadatamysql.shnamed.metadatanamed.shnetfs.shnfsclient.shnfsexport.shnfsserver.shocf-shellfuncsopenldap.metadataopenldap.shoracledb.shoradg.metadataoradg.shorainstance.metadataorainstance.shoralistener.metadataoralistener.shpostgres-8.metadatapostgres-8.shrelaxngra-api-1-modified.dtdra2man.xslra2ref.xslra2rng.xslresources.rng.headresources.rng.midresources.rng.tailsamba.metadatasamba.shscript.shservice.shsvclib_nfslocktomcat-6.metadatatomcat-6.shutilsconfig-utils.shfs-lib.shhttpd-parse-config.plmember_util.shmessages.shnamed-parse-config.plra-skelet.shtomcat-parse-config.plvm.shresource-agents-3.9.5AUTHORSCOPYINGCOPYING.GPLv3ChangeLogREADME.webappsocf_heartbeat_CTDB.7.gzocf_heartbeat_Delay.7.gzocf_heartbeat_Dummy.7.gzocf_heartbeat_Filesystem.7.gzocf_heartbeat_IPaddr2.7.gzocf_heartbeat_IPsrcaddr.7.gzocf_heartbeat_LVM.7.gzocf_heartbeat_MailTo.7.gzocf_heartbeat_Route.7.gzocf_heartbeat_SendArp.7.gzocf_heartbeat_Squid.7.gzocf_heartbeat_VirtualDomain.7.gzocf_heartbeat_Xinetd.7.gzocf_heartbeat_apache.7.gzocf_heartbeat_conntrackd.7.gzocf_heartbeat_db2.7.gzocf_heartbeat_dhcpd.7.gzocf_heartbeat_ethmonitor.7.gzocf_heartbeat_exportfs.7.gzocf_heartbeat_iSCSILogicalUnit.7.gzocf_heartbeat_mysql.7.gzocf_heartbeat_named.7.gzocf_heartbeat_nfsnotify.7.gzocf_heartbeat_nfsserver.7.gzocf_heartbeat_nginx.7.gzocf_heartbeat_oracle.7.gzocf_heartbeat_oralsnr.7.gzocf_heartbeat_pgsql.7.gzocf_heartbeat_portblock.7.gzocf_heartbeat_postfix.7.gzocf_heartbeat_rsyncd.7.gzocf_heartbeat_symlink.7.gzocf_heartbeat_tomcat.7.gzresource-agentsocftREADMEREADME.zh_CNcaselibconfigsFilesystemIPaddr2IPaddr2v4IPaddr2v6IPsrcaddrLVMMailToSendArpXinetdapachemysqlnamednfsserverpgsqlpostfixtomcatra-api-1-modified.dtdra-api-1.dtdresource-agents/etc//etc/ha.d//usr/include//usr/include/heartbeat//usr/lib//usr/lib/ocf//usr/lib/ocf/lib//usr/lib/ocf/lib/heartbeat//usr/lib/ocf/resource.d//usr/lib/ocf/resource.d/heartbeat//usr/libexec//usr/libexec/heartbeat//usr/sbin//usr/share//usr/share/cluster//usr/share/cluster/relaxng//usr/share/cluster/utils//usr/share/doc//usr/share/doc/resource-agents-3.9.5//usr/share/man/man7//usr/share/resource-agents//usr/share/resource-agents/ocft//usr/share/resource-agents/ocft/configs//var/run/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -march=i686 -mtune=atom -fasynchronous-unwind-tablesdrpmxz2i686-redhat-linux-gnu              ASCII textBourne-Again shell script text executableELF 32-bit LSB executable, Intel 80386, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.18, strippedPOSIX shell script text executableUTF-8 Unicode textXML 1.0 document texta /usr/bin/perl -w script text executablebroken symbolic link to `/usr/lib/ocf/resource.d/heartbeat/IPaddr2'broken symbolic link to `/usr/share/cluster/relaxng/ra-api-1-modified.dtd'directoryexported SGML document textsticky directorysymbolic link to `../../lib/heartbeat/ocf-binaries'symbolic link to `../../lib/heartbeat/ocf-directories'symbolic link to `../../lib/heartbeat/ocf-returncodes'symbolic link to `../../lib/heartbeat/ocf-shellfuncs'troff or preprocessor input texttroff or preprocessor input text (gzip compressed data, from Unix, max compression)  !)18?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`bcdfgiR R R R R R R R R R RR R R RR R R R RR R RR R R R R R R R R R R"R#R$R%R&R'R(R/R"R#R$R%R&R'R(R/R"R#R$R&R'R(R/R"R#R$R&R'R(R/RR RR R RRRRRRRRRRRRRRRRRRRRRRRRRRRRRR)RRRR)RRR)R?7zXZ !PH6^]"k%UIj?0:g/}DJGL+$"6Fǰyc[>|Z,u7ޗ͒ύ;"vs%(8A*z޼Yyn0D]aE%GdUG{2ZǮhzZpϒ %z>Qc 74gSF§ h%EwK`\UdBxT zɥ5Dїݨ ;NIl2iVZ=Hs]x9H",ȓ?nhhSXңØI.̵{->p`za=jywS_dآ-6s_R]wO2 ykh,Zs~b`_-i;V ~ bU芳/fzpLltW^G=ego߃D7I/EV{4_6 !"J|xN nR;9q^UmO!6\x&+2znj\{- T^>!kE{8,u-}[R u&SE!Mh$R@ Oyb{y"SJP Њ fI;4(nW@X]6 j˓rS_oDf_JB{b C3HbO93BZB8|qS$K/y}XVU.v!zQ{nR>^#8 VY#_PKYBcC61l/EcO8kxkÁ[?xw rퟚ\eEJ+/*)P]^ Ta0 :IÚq8Q@FɃ/б BXaRLtm#;g73.`[epFũlX"pp!")5D8/ 81 c2 ^"$Pt`զ]g\KoWو|}{N]CƜ~mu{BɧE)9}Fv-:"F+3F[T_ ˛ͷw%}7D\7r[m8g }oZC,P1IГ>e~6@Apy[ ^qO¦P$<7`k&'U?q;N A1OX΀a#/C^)l)h3TPd4cS-L|[`tW^v]D${UVnp;!t08UN] #YZ? SMA`pKRҐ~#X,TN.e\|+#⃨fANs(zq*\/CBM-U:izqpymX\ G){Te/ [[xSeiџ?Yʉ^ 8bw0t`K9D YgCZ\8Ԕ.Ǿjdz>< lZ$C0X;bsV\pJ5BQRH=*d'y=]|KuᯰwT?F2k)Jݠ UU{nBj7Iid#Y(>yeį=jxI <1 OSd-.}XȺ WϢbJ۵Mđ iӮd|]ð&9c7b #UGOdtyg7?s=/nO5(S;M jW埐.(KP(6v]{sQ*;W=Oyd'I@pS+>{Lv qⅰ{b^GKAU}<d@*K8 kc0RǻpB'qiG&3.3֪9Zk, &7xw1C<!={bxCx:Eb/`+dmhGIG`tzZz 0vԮ^{tZmGjo1^}kr]3tnA9I4&"_ՃJӖQ#}"B"u#`NS8'@>ZzlΞ5j໿[8a{NZ fH|pLf>s>xIot{ !76Wф  oe.j1K2Z:DNS]u|z}IIʯ8Lzh!x B~S7[ ^x]vm9?N+=Fty|MzdQнj΃sj MTGd9UZd:%p ;4fOZO?V),dm)'ʯxcȑ5EPpjZsTc1,{ԁǥTǝWLw8bf-qB6[aaԆ8^?6_ Q3y(TBNjE a RA_%x?vSkvɹ3fdjRp6cڥժj*j-|ZXism\A&}n~ x [;ԝ\l(GcׅkKy ]y_WѤ(P?cY;-<ݦ+xZ d&aGixiA0 }e|E2GMP6=ygAߢpS?gFk :j][nkŧ)ǓL{lBz@Yhd0v1[H-)T^5j볮أZ!dEڷ]^p/jo X *oxTrN}M 6i$fʥsjE?B' 5GnhL{~^AAϤHG϶٫BJ%cS3yؖc'.Tf56V DԃL;EPiw_y[8@ {LsxqR zi'z?| .,X!SjRuc$Q?2gC…h6EeD|u?UEBk3 ĭ.)16ipѴ("6 {OsU? ñnQSkm:qei'k z|w]j9SQ a 9똰'9ukSϾalyqt-F:3*x^W!gx;wnrw!HT^nVJąELbKOsS 庽%ٽ5np!vhWdA++:sSpnt؅DϔR㑆-Ӵ} W;eL7B&Et罇FJ[N%p+(b2c8^(z͑Yۼ̀#Zq\/b. ”nS2;4vό Hu&9"/觉όn9y[x&`q#W3,.偧hx1姟F.4&3 ^%ۜ@QԈc(#5/oa"m0Q9@,ԚUJhl[ y@ 'o K)Mk-!d2OBg5)fHOlO'6V~t`-_7Y5)h!Cj|NIZN)V[''=d;#-UkEL8^XԂSDVʿn #R|RT8{.yr!_ Snpf ݀`,e%[CAg#2@,DOsvNt+:q#* ?_pT@KhƐ{L˼BFqR9:`D{GFwdƊegRel@NU :x=X8ggܳܚnQbҸwخJЈT2W]" n$CŁ̍Ԅo).*bnYUQ{Ph5Uxּ(UR:-&-J?N~klǨ^i7>&+7.POZI0GDBY.%`4G?ϡ=DQWK 4E^rVШ!ZSYUإ1 qqS'IVK2"y%k_/gU>(6c 9}ENrT]HgkhSx.L *8Ձhf"G'E{E# MB_2Adv ;/w#n|9>b -# jF YBS-r]e[|?_$]>VUmO,R)x<_)gI^}$)ц7᩻J|qJRf wqboq F'%LNh/nNG7Wκzk-ZQ} ~`sđguZm_/5~ ΓMfZHTKs JWL_o; [7j/>mrLydG UYٴP_2k\xxLRRuoZʌ?pr!'P9a~0tR<tsnr+dO@!QV$wC|XٌZD\V$ѹ>n(1Qsg/qrCMsJ#ݩLqi|{fͱuU)TF>S;Wn,߹ mbJWJm 4+ RtjLTfdžNvt 6!Xj_ze 7Rծđ "Ʉ17=; o6wP9Fa{abs*i ~ %Yro_Եi薑 [9>˒ݫvVBm^` oeδ|Bح4á'rf܍ť"HO,Me-Nx RRZ2oraɭnnixLp5>i*.,9+Kx\M0JxFܯaɅﶈ[M{ÔO{0Zaۥhy~cg"T^yX;GJ3]@՝=rkci0vvK^3.rr9W#zk 0~oUՙ,vc=ɟ>L%T# #I?Y j+CI_D96u t:!^8hr"ʷx,7}]؟ʰ26Y9o \%OC,HTt)Kxc4sϊΫpotks  D> jOg}=JL:SSZ}?,rҶWpooE%"+^Zj+p3vA'r!&ZoD~(.`"~tdS =T_A0FzS.j>gu`cE 0t.ٮBq`f7Ju<}oEGQeA7%Z ~ybz~#<[=|N Yɩ=+5*q`AvXEt>gE[C\=}˜kj3Xm>:TwgӀ0(1IRJ{PPۂ@tXONqV@zp;,>ES]&U*GǫZ/Ny5iEO"ˊ6&TFXr{?CMjl%ÌOs^؍K蘌ͮ*Z^ ͋Ab.1*WˁUݼ=.:92r=AH:P:9;?&;Lbb;59 & v2DԆ! De>c;:k}: z<tHVԸ<$bʇeodF ;ѡvep(%3R[9C/vIaLg2f Αn yJ+hܑebe3n@ H9ԯf^hXR_ȐukWYsIapU=rŵjlAPK$F^:yQG\Dr٤f9>2oPH _+Anh68k=DHjٵ`!x 7L\ĐVP[dLh{|x.aaޞ-dV{Na?gdCi(ˡ=GVj#)* ;Xa GD6IC^pl߸D#00?oǎkKVx\zF R29êT қyV.snⳄ dksgQY|vTlk@dlCa&*\>+ZHD@GpNݐ/HSB'ϴRX7~y콨=RZ咾{5jE̵{0x!nd( F gY9\coXwMק^ߗuT @YWߣ(t*$}PmF+W71t to\_n/E潿I%t0%\5zd~e#x޴%RnDMqrwRocN_ENT0W.T vDSO $F"dYQ7!/f&^_ kIl4v Eޜ)=X SQVʖׇ#${7bh菋}@s=|٘:[JL6Z.).E3 N&ũ3='ed+Ecbo-ءj!9ÐV>/ L~ϣY$0#!Vf3 @2YzN:O@ҁ _ 5 rqBR|Dk>/ =9 b/gJ~3lC"f E-e sMiݤUm<_+0ٹ@GYx&PcLg6~GWsU_(*'@m?؋@ dUZ*| 7Rw?:Q&_1W8_EguIs2uH8[\jVp,J l[*M63yJ8I2]p˲͗?(]ڞpF- y^۬&=E ;[+^&HB'D2+PP{\&Ï` uw?jnv`0,k})XM fvqE :D5ea7UR[m) @OٰmG>84dϙju_*S=pLASqsҞʉh^N횳nu6&:a*EGLWO@ 6nzXpM,̫;{xWgCqg iEuU!͕LmKʲEK‰ߏZ@gՁoKF71 T\{uL1?+%㤫vsū/Ej }rhEŦ=Q-#c~cri^wg `H#uA؃n`^DDq@c ڴ/kb/8oYUWʭEYbhkgp,}Phf!:"]p:$%5$q0 s4|y^.WW>]u-\g㾦qٟ̍Yy|s ? d[ygi/[oLutR 'wu/FVD^2|oķ%N{uNg٧: mAԖp ~ H}O\Wvr{Hp޽=3+}lSav"K1|^=Źb=hl@=YSZg7`ygjb+ `wMNoֲ* =T> g&CO[j'lC6s=QGRRi1^ >;0P`W(.)IߖCc9욿xA̳O!t;;[90`cZf_y)W&Vpgsc= ӣv׉jcb#vɌꀹPeӄlר 3( xSAd.ϲDL-6D'4hq)&lKw>Iٖ_itgD)G+}hNЉBwpqR ÁC759AZB"LçO] mlo"xm@*]I0J%,J ~~,` T}F]Go=v0ml_tn%Q`ab{yW< 2ۧ:rNtQ|{pgb 7SWh v a<)4 E}_HWm|SjJ#q繿^d A:!e&Gmn[QU/jD*dpOFW%xqecddvrc-3)eN{>f^2>``z8F pShZOp<*/35P}˞K yO' t)h̃w2믔Oxt=7>o>Q+>!Qj}I)Фо=䆸Mve?{]4N3WLJZ01WjЀe)y 4gG{Oq2Kk*eܴ1P0')ؘZF1ނV5LvS^7n}+Oļ AۺB&V8`eFXsakoSr,Z`=G!Ay \UQݜ2s͟͟K&\wY!k#' x5w32UN\eEgrf6b~Рp@k[WQ!ȕkm PwoOάh[jď᬴&唂=~o~+Ȫ!-jh&T NgW x_YG#nS/rZܛh^lҧ4)>s?8WzBjh30z*. mw>`P: i5zxHH3a@/&zBrg)C ?RËo']ಹx !q:(Wcv I,GVeAFe/5#nokVu_׏"`&4zX]yEJ"BFjވQn@˻NO[w9)6+wwCe$&;`Q}lm1>?Rpgc}r-)x/[dϑr~//~| Wv@ˏ^cMW<]>!?JaŎ|6?ʪ*hE~.a—76kf& gʹӌ;sxT1`/{8l`R]VHrٜO56@1ye5h5\=&JR0m& vܝةmAWpAToeoQK=3p!-_FZRj,e+m¯0M>B=[ @Dz)^Yk0a!')Z5'7$i2 $ ^ߏPIJ,-L#Rr' ct\gRY՟#f")ӗIq]V8sxظvw545‹vzDŋ"j}Z޶x6ҋ/H̆v 8v2X`űx5Pm> E:?ͳwIuҘۇSŨȘJ$cZPƟp uJ]0,2h_@|pdsnbTQ}\ k]·pDo HSO"J֥&~5: &WM$ (3k @=PQLc>shk'J?a-̑ʜGW6AWJ9jOܸ]9紖}էְѝ rVU.Z2i4'1yy\tG(!MAInm(B+ rnEvG"Q'̤DpGʨtA[>{Rjar]HrS_F̗1UI f3IH7~-Vٕ''c*&:ܝ1)Q,Ԡ'!լqTdTg4W2qxdިtbpەp>+/ Wy)}9`b3o{sN WM5RPaG JxƼ(1~~sKz `4|>-].- pa.kדNGe1f Z[?opk pH%FJPsjէ -$ iͣ5vW\JkX"š=RtmePO f')# ˆ _s~.4lrbjSJljJU(\gJuVݍm]v y= z_ϿϵR8o1 0;v [hG-E WAh=B<}A,zxMDlpռ%z6,љ;%;ED4viثP> dsiٟ!tont|6f#8X)͞i+D⡐%8jE+v _LŀHi|;(yPE7Kby_ϔq!;1ԝØ0 ΑC4ĽԜeVskLžNd# ɔUӳ`Zqzr=`PeFU` #C6Q֦47D4p#@] O쨼qObp[jP?n6%%2Yt<[`6MQ߼Ɠmi31dʳ/<0hÄ5y+o+)XHAF KdkMZ;ma;e gHn/Wc" !Py>aM'#!E5UP(Z&%:ε>g顢fݫKz@DiL Ua$uZOpBThi#IyQOV?H ڣ.$|W _ˉ%K78 Od3&QK}0Bn\ATū[OX@⬶r42#7^79 bkW"Ηs%i{& V^X ‡5u;=ƠJ2=D{’8ti.$pFcfP!Қ!y} 3E;t4Fhý;QTx}R782~Ձ̌GdR׫׭&ݍ J ?=oY16^(t[EރEho,ff_&mAtbTboպ`\#;A`Sp?(_Ufcq{d%_c̄#v "_u< DBe8{)(;+:ʾ37k& \0׈9i޾ܴ"#EbuOn+Ưaty](?Wt[,?`T[L(~UU;Sc;9KƷnoS/pfsxbÊ(ʸ 1C֌G|>@Mˆ#=YPE`Vv*J8JkV頞K]͈ʴr[DkHnz^N.;PeXT4zHFHx}TBPUp#8,Gt疲 Qb3B})e*P`@[,t?^,t]3&1,ËIV: v|;wX # q*3Lذyuۓki"f 9C^֜)Sէ/zkaEK'0] dg4MvᇬIOxK;y"لsEd6XT18C8/+ +\䥿+E`yjlLHԡ}xE'Zqː<ϒaBm}Hׄ&bژiZ>$D#킮BzZ`\'lwCbR[$BL8+ gs(~C`Tc]Vu],E1y$9sns {:*IE# F 0 ?&8# P}q[ >{wԄ ~r%=D5̪WR=FW%9Իfԙa6yK0J"$GGzyD$ӿ/# MQ>Wf4w:3)ßKKrim>8?4ғw7?XK]Fhk-EOf\'it /ƍZW݌?_[L*9~iy*7Ztn,T裻NI0~W^UauIǜ_wT9/l7AT;JR4̝Nu)^U~, K>*ܾT~: >}r`p ;Ao,=- K7X=kV8kGz ;HZ@;),6ojXcšT括6ZF ?(_x҉#@Zoh4oS8]ex{wq Fْ"r%0k@?.Ew|jIH<۩4$dNU*`Y;_0P ĹDe!4hp'˟aJiBz؊ݴlEv2#?n*fH_zs 'cg}d]? ⹣2W+NGK~ Oi|m%!H]Di)J R,UKxXTd$[vw~t!!cHZm u$_ 6Xœc'*1T{9MQ4rnB;į'x_?}EzMZ SF{#5slImCh[6*+c1FO'  ^gIL2n`i U]͹B í5]+[hXRts} zϮ:!o d*C!cMUSE{;sB8b)l3 44fq!biVU$U)" |57iنcȇkFr튓 Bsf%SEZbDH59/MB3I%f/Y,ßŔp뺦ݰ6:M?IðNV%.{Z$'AiWҥ~>{O5X#"?R.ӏH'PW2٨i͠rL~Pw]FE2lK窡$O(#R `}c~GmmEΫN`^I3!ҧ-__LJaԧ'4 򋑴5՗$züIIi.q'_*~TJoJ?ЀF }cEyVas}ba\,|Rd4|u{K._m޲G5T6́ű|p$=tү/V%}rEю'K;TVN`m?䚍N i0F֕ow N5jN0ZN??HwX~ySLy3WNNvImU9c$",~ǘ;}p, s@Ezpwd}[MGLG0.j|M$ ?@8b>pufĆ@~zkEA7b}{om6Sy!-|=}M5~YTOvU͏ZҬcąEN<KiwPG#@o[ځmYJESV!!-Hz%i[=G"Utț+3da?ad/mz6J3ڕykO7c^!5*d!xk+3AVbIЕ!VZ"HsD>.ȓ5MuY4MRIr* dTNQXsD)Rj0L {n#Ev^yLpPpepPou3\$-'[Ч.~813M4K0`VN,tH @Vjtg&LPjEmGN-~'iLiZJv{߫6\wYFk?c!?#7O OCE&W$kBm*' Rm?ff3\LioE2o#IaU-|mLʞl4{3޲srlw`` ݂+$dΫEBKCVq'TljcoZ4; *x1[v KxQ@:,rBkU%qS'Z"W`3J%sU7Tm Dve=s*Az500(k+&nAM0gꢜEЗ&Zb-tL%'|n{#F=eM=UVU(pX>AkW6 "O^L <#Z N˴4qgRZ'kpǢH:! 1҄LARC+UANI{M ,@8t:ggW^"Is ]֗ XҸa^$oe7\xG2fz]iɤ*GMPjw/V*Et 3}z|4ǒW}jUKka9䴔$HE@fi_^4ܽ)T< n&Mc j8G09ߚ ozHOC%OvJG:$YoBHM3 mTٌP?Gu8wnQ*]ٲk/qƙӳ"Tr4d{tشklÞCѩoʑ % RKMцl ,X^$>*j4tVIY I_kZ&y^#8A& I)5jOQO'LxU[9hҡt&H@T' + `&EH%멗тކyX U?5 7y{X)<1ޔ[OLE2(ZjA&]b^4jd$OD},7\ˏq(Y.ub%_d6鵕AH͌ҨP11/b 0A_4%}ꪈŊOv_9& o}?fb4 ܠa⊛MEP{E/@L7P|rצ+|6gJ+$N#gu|0v{Ɔ-GS9(/jAO2!v~A8xO_N.Z'V_pcz73H{ Il\(ϦɶIURv]kO{@_`_EJ 5Dx#Sm.?ɜD"p#H g̘3oWӾQ1a<ق DxLͳcθ Jؤgfg^:8 ,DhMWVGH"k" -rXT**qmy O6 AöbBaʦxXvv+z-3t1CHw/3wr`ZvqIҚv]7R>+@ߦFH,Q\Nϐcl<7Evn FR! bd ?pDK!Hym0 !$֡`bӰީ`n5kvԨ}"xr*ˋqL'pKO>ny>pĔ4@D** b֏~mA(. \pxL+wq0=vIUXPS]dI$Oθgy(Ix$óY貞 ,D6v|x(`FΊdqdI7͐0keP#X箇r|o 4˨N3G}CF$ _K ~H؀‘?:ZP8yWL1n= *ٜỲ2vpcr(̖;ٹ/O:FNwI7~hrW]egY*fi<ާe6+rE3ꅐM+!6X'f&ҝCuS陘G+ ) 'G#]dCAS3pf0)3@٠oD3AIInūGztk VA]ϽZrؙ#uл|5D/ZކTD+PgYFчEj5&6.Qa09f-b\CD=hZ .{.\M qY׀=ꕷ3A&V-+ p.@.LjWYTW(Aq* ImmnhS}h`\`&0 +4B5]]WDѳⱤ 5|xӖϟk†&I:>,+]O%D'AG5ϊ  CAz^_JFi S!m{?T&!elrwvTy$nfH?(,7Ցf'KNvEB|tϨ,t 8㏏ KzWq}2 l_i"\ q >SvFPQRwotMLaSCg YOr( g2ܡ[R YW|z z}_FxwHL`lXMf C? ~<+Rmǎq~+LX3hK嘢CMbKC&ibF/SŞc%4i+A)P97ѩ5czd݃GO>⃳S'*^5_: z5+Dɞb5$=әqqS. 膏 Nvl*{т(%7z1)6%tREY\NLn:n(zړՏ:0i8e@ޘZrdMY5.8J+i/T ѶPMs8 {S_ݡq}}_K6GXKTpN՘l1𑆶 *= ^w@\M9)9ؔ*(_ G#.?8\XuLX|ƽ% .ZW`-2"d?#Sr"Fzʇ]LRSL[mH'-o, &\eä&n?HFE4@*7_W,"I5̣HѡTщzu`A um3ns$O2mu(sUlmpCPX[!@(pM@9a-[ TZ|o9PCE ֛uEQLCKzYwN5/e1'ZG3DRݺCW C={ZsHQzaR.mߟVTX+A)K;4jJZ&-2|c9]c56S9Gu.s%WA z}=@ 59/_01Z ѝ90c=™ ݯO_Clg5Kբv5 ZQ0j g@SU h#fkfUY}t Bf=iNYb\L}al?-<;)ws=F$* XOP)Cd( piǮhl8:^1+M 'LӤ+]e:ԧǁI{wKTR$qd`~9p&ӡxlv,{s:{OיXҡٖ@WK0[Hh'y3`Aa6YWޚK~$#30TDdžʰ{83EBj5? ց\TEΩŖt&4s_3Ьn!׻&[ҍMή4rcZS_sAVoGjh0778h%*S^K4~Q(Vm2hb=h-( Dx)/qߵDRnJaEi6A 7QTȳ 2kB vw9j&mח#JֈOƌiLO?-^.nR&1`a s]i;MT l:_PU LX`%bTƯCdQ@q,lB(XVp@v/c&7 peU]"y|fr?$`zŔa""JwrL{X]?-$)6}M*ig԰hhV{%hNdXV&O0|ޝ+v(?S`jYwWD(XXyBv+0G΍J'ÁOڞR~ʐ7ͩ?LOkD0ۼpNdaE"VF[ M2a!@ k eFt\02]^Nl$UW`.@S<2}k\1wkdDEy(UP遱߁nk&Ŏê$ѠƝ=/\º]I^ofԵ.ֱW0RޘxAwgTi ov"B3"ȏxnMf*%5iFhܲ7A>n`^W1p^(x\ :ɠB 9Iڤp}ѴEc`{pxʒ uro5 w׽^o2{ޚQ'USU_]۝~MSٻ-3'ru"IK o| cVl#lPnVOFbI¨c}4My~E5[1ÑbT=F ! Iǜa5-N̻x\q2FYLt=| BkrK-'u~e=Oog(")[Y%2?)| 9'sWG?Z@JtߢpVP/+R*YZ:AIte3ҥVvIĊi2?[rqJ w1;/*o6D`rni4Q -sKdެ%b sĻh \k9A2|V QrdlO0(vn#Ik=%+/4m#ÔAxqѠ>bGΊ٧EPL{d^ .bORP5"a!qEz5H(y)EkzħMa_Eljþ]K6oWX2x&g;pXe9;&?2|I4QBZ٪Q[ PЗL6:mGSvP2Ѝ:?n8 $rI.4>jrf L/!]YK"}CzlCù˷gί͕CXpY%-U)=&2촑">𸾤ntDxg_'{#Yg:BW ;Kn Iq$VN(N,2zӀX) F8GcC 9+~AAZM^/Y_"W~fYf }4A|UV-G vTm@vZ!3 čݝJVr01,6=s{"O롈}Wm{yF_m{8]8_$N j ne7'ҟ*{\ʺoʙJb#t򤥆ji p]%!9`loȔ E/?OA]EJ/?~w{A[b7CL/Sn|3 d",=[5bwK|s@(~c{ӥ`jT~;0&:kXA`NLlwm#A\8+jKVT@Oʦhɘ5ƒg:Tu ̊˷7DY7a"-և23TPV4nM !hi wYk^MSY_ )ِ-~*/8Tbsx@ AM/b4_nLn3A_ @3*v@#a D5+106Гylꛊnm*߾ t1/DŘ+Z^cs9/D-xR =>{/qw Q ;f(Z1;<<ߟVl)\Z{{bKkbE.s߸VL"Ōfj,} 0T*ѴrO&~A) }yP  ~_( XG:l*{t'I ,/Iq䞠;"SaN`ꄮ<|k9c|,¢K4s6a[vq'`8ÔQ2Hv1,&q |P5GzuD}ߵ8#yM50H@T$HP NGE2aF3O뼙#㈰ۀw `F[\22l9. }='lϳ2blK֊۰:y cf[tJ}׀"EF)K)zqJL5&J]&X@MMA"iYkC c3|^jOD<T4OMmXنZ7xU/GGh4K~uxh:(sU@H%IEAL?\w^YjjjWy[}g&@z|"ڛX5^HqxeV$lN{|gϛqh26]rurO.( 1^6O!la]I5g}ǼJ3Pu mup ̅ i`]hqaCĒko1N>_g0:Nu|asFkL Dٸ˒K׳x}%ui)wW/D=aoa^Юi!YFL,#꺥>%vS1Jѹdcm.yڃCf6ƕJ|J;.T,uP6vE65("t[kWyOg\J3!H:%𹌹Ya{ҜvǝEs ?lp{E،WԨAX6:B%SrVI(-A;s*B?oIJB`*7ap,YPo: `-&*7͡eai`@"<\>Y,?w*ѷ+3Q226 Ej33 5@׳v~Ƅy2Y$Lɵ"R 7 bsA֧@nxu?7C/w^ԠpR|Mx9AƐl.j[^eH0O9K!LMh m<;3ߖz' ݔ v!qcKK,`LL8[uQң# n`N.{+De\xWOЉ=Αuʍ&HF<\̎-DkO|ץceoM͒PyvY o +3|k.ڑ:t.8چvkWw*֫FۦĬfDb6y +S>•Ƕn$oA-"_t4YmsHoO#fE HN2_GHJ=^ iFR J1XЅtG(̖o'x* < u8gBV8*A)tes'[=`\0^3}˶_V[c'mri }ӥ!լ-3v̥i1a#ŒE&׌m[*:{\x-Z<>qH% ^|p|$8ѥƠa/,˥IGm~u|"fX jAW문jGEdғO00i0.{%|oH]",jjp0N @^ _Ro0P$[, URX]R LQ,N;i"O7 6̰%VYO?ӯOp0ɩqQhlNԴ,qA2Pĵ/R߄2㫘6&aKX[m'mkj`60qF'NMV3^'ې-T-3C^NkT13ޘg|{"{F.;W੽QN.ӧ԰;b7Hz_pw3|R5'(w/uV9XP: o^9Wght0  c$DtZZAb&T0װKTŒl% p,ӹ G^moËez?0si(Bp|sOhF=o&2Mtph_xq0{:-MbWkzh|Bo~\* h$M: 1IHA'Q Hv&pqJl#1YgY!j NzFA!MM]}ܬӜc,x+at'"B^N|q +*9 TǨg&}0xJ\E3:W'h7W70^jM%lͽOKAi[1|FɌ 2a`#"۾ NIMO`Ω|0g; 0OzgV; TLkP\Fqr5O:A@]r#_Fa*b.ʲ lݡ_"WJQ*9RJj_3|jPc6ZWX;g,|E.QdLkvbB m|(rLI튢e"ޢۨÈ۲=!>h '_rb]  (Ye $u" r|Éhg1ꍃ|+Z1B(1 ,&zU֖4vн =ʂ%aDJLrsvvBQ2Z,%o3>s04Aa7cxٓ8-6.\-qGO.NY;1ːOuf_DL5>Ü$uT5G<@tkDY1hpA.["eAK>@(wId&NOJ'Mc,?|(x}1z˖H)?PYtٷ`9M-3e]y3WZr3\{![~$N0vŤ 5u4ul v.K:~)x6|m`{F'̲L\Cx98?y!k{2wyH:HOa3bw΋oM<0j&#/(LHO?n7+*\kѲfLL' x/p ?iDY_r;ZT=׎`z(7]Mg(!hN`rE|[V L#(z2M*&t dV"Kz~[?ͶOlo8ož*;xL!ËDA%[@5)O϶9"el\8v5&KIRS%'/3$n\MzRXiB2`~ DxI 'qrwyrEkz#׷Z Xfh)ƗY }LC„#SĆ!ڵZ0, Il"R<5-~gŻbt@_i܀h4, /Жᰛ|'~ 3 d&G%UYD03D\„!%:4ꐶa5$+>ApAۃK]x/ֿo: XlU|k8ˋrCLcMlAFM>+H^q}RX<: ]FYc h-8!M*JQY6k1~i8?n;cAMSV,_@S  n0_^dd*^GI:V!8*DȚZ%(P uj/R.qc(1IpW2Ν7O̰Q×4?%];IL6e 0u/v i%p,ӵDO BC#^c fWl[0 /~ВPmk~\QIzLV*, y*{X=t1*OCUb{AE[T(+W$3&1*Pe;J_#@$6,p Lhaj'۩@]i6pӶ ?}s]ǁ|7q#8ňj JQʔW 6ڨ56ó]ۙgE,)*֥ aNɈ\VW?dԷ8+T9_<@6a)Ϙw%ZnAT0yI *xEGXA<\55c@y-WUK!9۫I]f\S]"|$;}s[fbB_C:fEj ƒ1#0qgL\sUq*Z)ك|l<ݟpAÀ>wҫ;|c%tTZXFytBSJz9hNk&tL=~,2YIUWB~u:`n^H?9WQ}cqpwa 0B8n4E2"Ѵ̒Kbixqď1o_+7AMxRЍ{YCx>!dFҧBzc&"crJߣw|+Z7"{x;a~shƕcs]>yژHH{3|KrM풼)=  H*qE!%Q_m]]UD+ms;M$h5 g 2sw#T"Ff:|kR7"2Q4b܈qb=򌓨H ֻ$n"2sf.*p0Ma7o+LQHl`Vx^5$dP qx| szw૟"B&M @sfZk3uSB6_%-fhk_=2UB1{m'&XjL0:d7W2NsȄ b\1BN:#'ؽ Ǥ7B( loVK$$׏jH1fkP&P`*dR^ڧ\lɂ?zjQuO !`6ˎmb.[KZ7"HzKwv1AmN<_ 6 ʱsND?m`w::%O0R⛵TDZs@O-X5&2fÁ2b'Q`Vc~sm.*Sy_&ڠ}t> hI #Y2ݥ$ٶ5G4 ?5l<.T(`~)nosj}q~],!:4"̔6)鰋{X!=n ɤvTez9apH"KMܽL1ib2 / sU`G6Tv~.g9SDÑ\%oW:ZA 8f)@|#F=fﺁqJ|RX/Ԅ/WGlg@fCgƉh|CƗl)ߝ;9 =aZЭ$<(77wB L3J D: QCK;MĒ8%πu{d:XY;;MFϢuRPGi . v/6SeӦQQGL.[M†cjQnc22C:FV{Clod 5z'c}2Gp;1b]!I c2xhգZ%oTAĊ-0̷BAM_\R"'5øj͝E*$xW@!ji֝dVHP&0!M4u ;yz?/g[VprK;%TZ1IP̳S"T;i B7hԊ>@żՐOs :@b0>_H=+ Fr-ڧTokHU j!7讳!̊ؾZCk+6˅91bɷtKO8wm;MhVTk 5'go*֬n{C`JV }qT=t.34m`bS | "3rdTf$(-z4 1:]1zT#!Or)[":,yunww gXɜ=IrR:`\=9`6v7kcFҫf)xtg kd1y>JkO6F#+ge3q03$'2K|^Cɔ'i"MېTsôQ"jFrwdZv5O;Za7BbD}~YP;Fo(((լ|+J} CgF Q2v́`[DY8|52 K.8J"hEgNzT>eWf0z.J0Y4kli/Ah&4"3*`~T8P܎tAwa'zp9 (C2ĂRrVn4 {h0/CAp0nP9 ^OA276W|B DQ)ʁTO; t%f$o8V4a2'*[/&b/MYLueѱ> [fם*J#͘^p;}\Q `ݳcΘL.;OʸE4< ŲĺzbRR2>-%t5]:F 0_xgd6A>7Z\arh'-C1FМ~*<4H|`Ia*voܢeP_Z1:h.K *&%5B0}(DTo'1= b 3JX |WEm)1+]BLaSHk ENik,(1!5 By9;羣нI@J Z R=sQ[𜥕_@S0TZ:M_zX v=ql[l2u&ydBiׄ?=nUf& %% !baSP8!:{Gy*'5Y}&Lf}R`)}'%} i,oچx6"Br_EUe$^ ܭz`wD$ ͂@F`jX#  oɉr*,~Y~jDx BnP2Aj}լ/?M] E]&RkM0)_Q*QTX{[Vzg7Q!?2яG$i8k}O_+XR&0{8,{xz:y:,,gS8-@(lWf oߥnj"A>qZHdu̖h_EpUmf,Ӥ9ǬTvǐGԕԌ{8 .y0RIF/(RW#z5sVW-OdMQl:ӍU;{H ՎH09&M4:mw&d%p[0u=51TBCyYѥRQC$$) ̘b?^0Ng bcz \^r2+<)}_./!"Rà#߯?q\HߠLEo#T14pݚq`Sكh||AJBB#؊8VVRl5.*LmBɬߖ($46ۍ2Lc~2&ƹS1$҉AahWԖcH ʤ*C*V<~Z/| Hj _- _[gV(d1aW|RoDOevFvFX}rWYc%$X<NjL. JFƞba60Y ^׉qIghZ:7wx,g+ i*ŰR(emhgЬ߈d`Kp0/ ?gBsӄsay/\m+6bc"@b2rUnO7=~)'xIXZ<=$]='aP )zΥ2zapYG!ʝˈb)$Kv.АTZ OYCSnJߊiK'.(h&q{.k]b_J v)J)4zS?L{EGddtyZ)1YA7,ʆJ,+Y'\}^FRGLH7lzЋ{rR@嚋b <v 1Ȥ%Y2cB{#oG>pfw︔4A}\]8ӯWH]ZCxPu3Vƪ: +-W6RCsێR ?P'Qwe&ۂ])y Я=x+ڿ9ڃn. VvZzJTdyU] BҴiz"z[B:Es:6L$'R%; A4tIU1Dׯ#[s iQi4߾SZ}GEtG?h-1|=cf=okf&QpO+b 9VNTg!xOX n|,NȅWݫwMYIPRbԕJFzN?0p8i.Ð>/920̎XuKu#͢CԢuC.` -"Ea P3XSG+Q,ϫ8THtԳo&يK_g&%NZW->cw:7k1 />婮rB$<xVweyLO<d"q8 u/t!t |NַEBcH|+;)@zR=O=B&)U ҔĮ{Z@FaZ| ja0̗r獓JX#\.ֻH92g1uPB}0ฒLl^܉]ސNT {Kr̞zV/:ß֯:p}7^Զ̓ C]DOm۠D:Ԩ+m̺(]krLncp!B i[{)V#E!łd7fw|?@fT JϞ'i6VVB5QX'~X(j9"O[*Wǎ1&LK*=^Қ;w{Pڒ)!&d82zgT) bHLz]yGK9[PBq5T9~x(.;yuYAKޘE<̏PNn,}P:4K]𙫌OҫoHH(oPY5aGfpG۱ƿ SFQ~?V\PM[BĢ<8ЃGlO䙂>_%QY Џ3Q9LY04|ڠ65z8rս`g|־Œ;s2Q c61jKe2ƼD|y&hY>t_Gv-zӵi"} 'FRG`,ҋyqܕ}?+(HRF0Q ?SyiDYFp_/ͩ{c 09љ>:S7t'HDLZ!f:Q(.SѸ/!ćG]DqgV`\V C*|~l6T* x2!\iP"2ZڼN+꘳!"4ۑsmWgcXj4? p}n|g%QeZ ?cρ؜vrQOk"ZCKu)\7moX|[I{`\^Bmbs3e9 k,HD CBʭ )tfK Kp?LfMnx`x4sG"9b }e4 f//)`勋5 >/.IZ_fW q"<.j5]EŮ2apک˜hm-svby=|kd ."kUJ(هb *CpՒORm5ObޔPd]8G< 1\~>q.Wd+>Te=D;hU&(U^.9;j1= "j]8PrU~7/fEPoR}V)$6o N`>*5I&)1/mG h٧󝒡mq b<0-0$hIgN51&ʱ+:Hm%(S?ߢ uGZz_p,_nRl܍Z,/W DF!ƅCXBpA@P3OC櫪 IWL-Fi bs' hNx'`YO))J]O8m8] cWB#`ZiG1A2#1sag :HW?G i#2lz[2х1g;qO\6qo6RpR^oǸC-L27מ"=նYIYzΣOG@ͽu2no!xk4 &{U>9d #u#4#)T28J9Fk(QNVIdUv8?_>b nw|.R&%򀜨 a3"]G9[b>H?IJuk/g3Jlc€n1Y)*P{2c7oݲsʺ_>%nw.23kRM(\<)Wna+jfO{଴EuvjؑML|D9nthMH[ #pk= lD3)tD7}s?Nyxs/ PIJ .kF@^PjCO]`M bA8/W1$Ae &V;R(19+v_":Vx G4_[7)=8mzZR*r[Jf؁jD.2=CJm!z^<۲Um|5?>XeixCz'ZGK2Q5?t V>0jējPDuDDC"6i<[V/[3>_E7RRؑl"x&-bwo`0YT0HuF*1w%<ϑpT-<㓬\(KP:Jy=LuO|'Wsi{%~(3ӅJ& wIIݫE?X*) ܯ4XyICZ8~#?:f`eAPc b@`ֹGu%餌ϐꙅxCne))W`iմt]$zN 1cQ cLpwm1Zʙ ȳYʼp刌@|r75+&JʔۆZ!DFnVn1,RI>Liͮ0ԌqeCFwjHKEU|rlKأbcY7w(@XKZLrY0`R N"(eQa#P:-ArP`f*z3̦wcI9]wn,;l}sx6 RNo~=R@F+cw-!G,\+lw >>,IR$.?䘚ghu V%TVf!2E+Rp#~J')np~R` ʫg/ل x*?jYZdf j3%6zq'Q̒L zx&@x+-Ʌ7? 1Yk4]^QR(>d8}]LQe| DVM r' Vq8yQ8޺W.B7}eC"[\ؿـ.}D58` вAkKtʴ Qn4"Fo3fIy+̄6"h.J躝)86CG1Uf!MlܨࠄDDQ=cʉOU[mṿ %ml%ğ 8:l( 4řhke]`}T훮aC7{&J7!qة@ż߫[-#LtP2ghBO+p̖ZdԆv#"A=5D5l[C0((9tRۘ$ztKP1`ػKR݋=Bsu_aFL6JWͼL[:% }p3YWLzS+|\JГ+^ Mp@w9۾I^eQ)µ۟ <}5|ڧDW=n]4e5!}.'yRwb#orr<:t%9 ‚ܥ/<+(y\Ó>? Vg3MBN(RZ2m(MA2Z,a̹wo'ƭϨBj/ttf#S8&k|6p bi/0(Ȧ1Q fO{ںfP76xIyr;ms2->>5V\} EE&mӊjMRoa03\XI,?4 eF$0em%:y4N^UZJ5h|GA'^{DߜzKIPEx10J usXLqO}+ %f_WSj"Md|C̦M}lpPs`ϮuOՁR;gFg&vE`DJyҌxo*)RTdl]}4GwvzQ 2E쟊ɹT\{˰S(v،!eDjoChϜ?'a6cͯKZPD/fO2-c7~CBw{Uz~. |! w̳/Le쥯D#x9*-ODrtӻ n|>#`=+VӱfnrܕFOf'd1s8 Ey% :0P (!|s Ehy0맗0vL|Pܳˠnoї~C6솋;]\0L%ztpgvx)]k+Qp(^*Dֆ,w7!#aLvn9ݍlm\ҹ?SAR|O\]t Id'bɓ}0.ZOȪ{'+E,zbpHڤ>=al:spq*rߞu_:>q.i\GfS%rlq6K7+qrW-DkH Ʒ"UK5Ȝ QJ=/08 i&unUbV&WcR߀t.KI|eJwOa_onU^1(bUroWgv9WxOč%ZgXHGZr(&ɊPMC\0o ZF]1bwͅvEG nT9zAAjar(9HT抝#QԼjX̎TveGb<۲w?R}kikJ _+au!T鞘CB]/ro҅^OeeF)w8b ͐X)YyslZn#z@! [\#ᶌƙ" %LbVB<<cagJӹLe[+5å{jM,IxA:xoCXt4>[ Ws0p?Mj0`]n(˛?`ͮ ȿ-Θ:I gPP*YPׇlqe'zeFbĮ6Y;Vy Ŧ_"є`8V^\dᥐ;-t݁8R0|~ MAbp~?wΛbkB߷~=-ŵ {znßf:m:Mk&37UzK:JDar!e#; +vVt/~za9o*X ﹰ'lkC+yKuWSH}Yћ3G_yqM_`;_|y|iiɌ$kD:msGYfR6oOaՄ~|U^2>?Ԡ2T+,u&Eq y6)O|C~J/}g @ȤO>GEB\L+W5%<"[x0*Fywuь2 Jpt[F4=i[i `G XK8 Wr X7cx Qˮ`tN1$)q%T»-[5x6[9q[/Xg0f<:i/$]7']U}ܣP.,щea! ڂ[z ڙ>^> 1{l[ Ph^LgpeUC׵roֳfȘibAd3wT~(:zڕ>H/3;Qӌ{ބSZN|^<;2iuAH_*]0{2?ZlznT5 cnEsʉ=Nm3BُR7"SHtM7ۢQCOKW/lS@}b^'5$5UNJJ0k;PgKV[Ƣ^m\%~ ("}B8DiXT Eۇri+' 7AC[wF~jAW8D}ܹFߝxp IoR`] '09!}zb͎)<[*` `x7Bm a1{꾷FKKky!+Q9y}_Vb| V8%}}[!WʖyB\kQ%cꭀ:[u^ F>Cօn:`dP},,ڢT*^3/;K3I5ZmKk"}jbDOũ<~jAi[|%Fz+Ʀ"6gy2<"=E> Sy(D߰o2NzanAˡ!?YY`k&#z|04]xԆr~G+田$4|g}o_uԑSe $r;W"gҳz_5@},_5ܿ,r[=h*4תTLATC)]c=A=Vi-_4`i͸5>yf ]<ԛu?QP^-lL%ת(+*DD)k$a .fe,$TӘ5855viDe}0 wXc\r2+GnBU,%g9\G,.z I5wv,LrAflZ`KugNZJpxV:T`Zqxsrr 3! LG9߿t Yz\tUowS)1.S_fjOmo [+4p K?\f;JͬN\!dGU:TN/ŧT\qAb)pV}=bŒjDUuGn>ljhc ,rg]ڨ^8\R)_u=Ji_{1u-#O*q܅8^[3nP%{>b=|l@x$DMdL6qOd+/جR_ U8/}?ϗAVKO 7_\mGξځ h춂`x\HfBnDE Y X?mJyk I`uj](oNxM.]P%%[n]{+ ! Js"Kg;~xV40=h`=0XWn$ )q}\^nk+eLM|{cP+ش@Ujٹ,IKIq(ŌGIWy Z1MEGAхVu_3Gz5cfɟ>c +? ,O-Gw<`(-D, G=:6V53"n=ࠝEIbƳiq5׏vmYv{nЧB|Bd/:&= ɑG% x[,S זvu:iod4=K-iJ o"B>NcAp-buYf{wK03zB(FۡϧeJqgcBBʹrDBj$>wu-W^nN9cmeVyfw#IvFy D IpL}^A@y8pڰ)cpB ތ:=Zx1B3,A06&VZ/^J[NXww弬QE-rb ~]z xɭ7ns@pini5Mʵ8AUQEI%MAV D?[d"0V_[ʙ;D0g'pi5)*Rb<?~Ou=VԑfJv#} yw1})o$*KK}Mvju2K_q 25mr!Dt]Pbk*slc$ڏ..@.F%"_\s>cj}wr"e1ß{Ӯj-ؾ=fJSmcϬ/`_9}".=SŒ]vb"pCE7cơuS0ߎ[#L7y5Yl5,D/ylBNWyRiΤY4[cK}Hpk=^ߌof?)C01ފkt$H jN w?m ^G]n/JxIJ%#vqRx]B$S7R`2QᑿL`N)/TGn2HN5҆$m^[R;|DA?P;(݉? Wv7z;Jr,sDU˝ߥ_kn1>.!X/'NeiJ 3 F˫"cK'DŤjJ[$vs4Wjie6NAfzNU)/78trWJLOfǴiXW^YFk쑈^'ݩg<Kr0>*1ii>VƬ%9Hocm[T*z^vr[(+\K/P.Q0 Rvd 0&/}mL_bLj/-_N~qMر&Auqc5̇S:O2pJ; U(W8'CXD1onmcOqKRQxs2IT*MD%Qef&dOie_Xyn訙%2Km;,76{C3,0o+֡^Yg&>Ad'ZgTM~.FrJ·ΌVh$9/Ɂ^Y2dEV1#v ,:%mYW ?piȣ ifB> Ι4F1=uiT{B mсeƢWH_2CAl0S%CÓ >SS}{:g7W2&r.T"m$.'bBͅe u>ZBpfyIx羚{JY3i ,a #TCsw5bqQ#=7YGyOiVzYؾi8y[AP HlkgJɂR<-s,^H mÂ|LǛnF̒ W,kO'Xl2t25ewcppY 7` 'ZThշfF?ޠxuA7W:\oRzi@ٿV3] ̏ !v 2;" 1ʹS!X= aPA\4kvH70b y`J25]y=aW$<~0fưإ.DR5c`ܺ&f?_C)Tqy|y-[~m?-ul8 D OLάe^\s@E5QUƅӞRb*t[!~:V@gۍ mYu%;Q4)0BOhFqJ&ᇮ'4֜qz[Sp: 'q0vjMYq.8; a=54,NhCbQ8%ٺmк򭴋)5$򊭭owsԼPl1 f&P.N2#u8%ռrp q1Ŷ?Hhɼ : v .WL}aa !c(K@_g)aW tFVv_bJB˛W׆Q<"jp9ݼBt>>KXN*&vP{0S뚖Iso:Po6gݔ1EymW,Nɋ0Wc$v.Hn~Qpϯ3 @8Ԭ5K Zp(V X-H HijG1@>.Z׷7jwB9diP m>` `%e8tk;/ :N<TySVRfmѣV%j$Zъڻ=t6T$28=#0ʢR4)i `gx'xJۿK*._‰1\hMD2(t ɭ$KdtUjp.(YxR_pO[ƞRs5>a s6=acGQ"qqIt o]sc ~Ր\k=`YHRgn2O"k~Ք4b9yL]sO`V2QvxPwXo dx)ԷA{<U/O4F0 s)z,^a@2f3H/obaZ܊z̽bu<+ut7;A'7` :5Q?P?KmBFR%]m;YLgS3FY T;x|44}<7g)MEnbt Pob8IQYF-Q' 0}|nNJwj?50'vώHƽr^Q:2D&3G*MQߥ1 imf_Ŭ&i_r|TLD%3 w(%o*uf…-WkR!ϰvKWSn.LzsKmo?W&>w +Xʍ)vw*p `zIf^1<Υ}REv0 WTyaS?Y!ij05} sVMLDd<eј[jY{ӼkxħM3v?ޘ0^aϚ/>ݵ.Ai9p/965gN1lxHXo(IfN ^x32CF6<a(ZT7Er١Q&:OW&dx—ϕ4>;2Sv.Y_d Kpb7igЦPN%7#v` ,`MdZoIE!v,XGDg1&Ef'~:>qПMi11rqD ceP1z^ߔT+&ffÐPk2ۻY@ ry5cc·sldTVx\'JdnoHQ$R:X-J~jy*֔ *HOjrh9p[>5ZX=?R"g 8}.:6/w}[|i.C* +7#s Ql1-J>6U5INhQѕ#o@Zo>A =dM )\-KʺZJC ??fCOP[7 K(^2) ڇTHjG 'F(kf EM{ f^]DWyJ,-yNs|3a9`GF3ҝ˚?cs0f 1h]RɃYvTڰZWՀ"7$KEHhmԈ"bRwv[UM]߹}/(kM8& D@|#!MyfJvS D"ϖ02w ƲBѥQX^H`Z(p铹p\" lVGMلyda>6JxOL3Z biؿei#!15JƦ8cQrʗb[7PpB si:\aXҹoJ|5٫]t:Ǔ謚=r>#(~p2fJt;}uPn. 4)vn^4fx/R]7m#엃76"dݘ wỤo^ X)m k4IͻM.oK`]e:~dUMM^kl)#Q |INfoz씘MCDyHX l0l DZRܼGB<ǨqR}kM6U&^2Tz\u' :_K|a w}R/&0M\) Vܸb90Cƀ窋2<R՛ W[&*=Y8׀2}4w 4VYܕUADF c:נئ[N`!<ʇaSe)m x.X NRጀAٓ s=e&MhDjäݖӀ_¥)K| Fa$2iRN"}j;)K0/' 3 ICj@1ӯa亶rvgޘ2'g/ -ܶx.UpZ{ {UPkʭm^u2{fH `Qa7[υBkuwgbe(z VyOq^^AE|fZ虫s0oЪQWω[Oqq4_Hx[}]Ms\ 7DXΛ6K룯O sS 罻qt1 C4& /l' 䪟s5'6L !CNZJPL|Oݭf!J s wEp^ {E<@CQ]Yk91ám[?Tu|,'US C@Mm#z8 B谷ۊ!o?I)iC'!PW|0VmV)A#|B#Wm=V2xeS|S&vIJ!a |wRQˌ'%wA_ 1q7jv?^kphL3'hzrHxRQI'ÎY*^&{= l|D<6+D Ե+qD㳽 )e [jiID/0RחqKqo<{t5@g#$-W1~AHsP'ڻZH'ʔ~jżfRQ dGSLGagg/}/rYs0含dB4ں[GTմ§G>Is*+賏tq>έr[÷GB^xn.:&r}v#g8$I~# @6=cuʻ7[,/j۳3P 7r7vge5ȸƣ&4%(Vfհ){'c21!X\4Mu42`|LU&Qpj\*VBboS-#Gbgg%Y!DO弇kZA'0lADvEsP^G#_@ ,H|foFU^O`6"qnEw$98Vu3+TOl4"Ox x' 9/s1>׫RGXc=)tIE,|:FFY$o[s͌80զj08;ld]BH#(F(( ӥ5`QVcQxuUl%t<'}bk#~?ݰޏ59M!A*O #1gUfW'B% .#;hB|ԄB;{U \'NvlN9&PV|OE\FPazo$Q|{ u@.Ҧ#,,p@R}w&65=x)'2jTi2+#peo穼o9>6ulQkyPζ6THiNOa >(B{8d_N3Ćh`ʮ7[`3,G^/C _0-\pOʺkR:HF@Ku -NY}m ҂-Tig5-2FZ3?jaȬ!kKmSt/1|UVi]\bQ,)(RʘЪ4 *?ؚ{!|;hq~!$bNo؈_9IF8l=!mF4,WC"=_Cp, U&Z!{dcbb̾?(5~&,dЅ^-6.BB]:@?AK*g_ŵ?@!PߦL*5sP Q !c)h-_f;Gv"ڹL< xgzk k&Ԭ妏=ޭճwwX5Id> 4t Ѯ|$TsVp ru{m(Y{aӧJBy8\`jU蛲S]nT(|-A텦=fzuj)1T`者Ws*|/ >}WYH2c&_&RUTmM=H]to ѸQ]YK@+mKcbAvc 3* ]b v#Ya0a'CG";9(`*r4z"N 8ZJ,>yx3κbϯpvspvC{DsN3LP+b.t;!i1~ϼ "t^h'6 S+T+Y/Iӕ-vkF{?LXiI!%~ƅ9Ӳ,oKpM>nWš8 YprDqM .6K1cb?d~GEzi;l|$צOG%XIz ݘB w鞨Pڗ.ZnT%'$d~KCD3 S{=Qad<`+X mz/01iSZ4ޞ~j`>&hDVX)ˍ63K{Ӟ"_:DKQVj?x.Xi}:p)c_JuJ&ʳ䳠hXBn3#R^YNwp,ԴfkZmH#]S+W+n88 |LMGHOō䣩D3Uc2L]_] c^XR+.^ 9Uh/#bIk:g<\f R#PSi(r_S8 {I3] @pKFqUXz4ƙ5WGqSGTVQs?++y۶%S=?1dž1aaI'xjM͸2 ե[EȈfoZLo:9\u)U9O L䋉n66AŨu ArmSҫ6z~Ǡ(i*Yy# L d;VM9[α/uģT,zzc >'Eݽr`e"VIQ=?ޞh7ZFD[ڥLL$ 3a}UX8Qd ݃Uzxx'vƏ TiQ? c܁J(mAlrU#BS˄PDb?m2_R6dHPtdeNW7F0"e^9"]K!QxON ?Xf!Chm.}c %VU Xhɶn;:t1k Jqd,/34`o9  L" "v7\u'U&$/J}olj }E4anyD&;RQKpVir ,ד<]?.?Ӎ>/W^/nEn&vMgW>Ո) Ma~Uu9>+T SP&'3N sp('hu]+ZW.C8wۯK+0 Ǟ\U֐UA>!MDj&lϩz"0. r}Ű :9lt !̧މϻ͝޵09">IJ;D>/ V¹W+`g#72U1(-PDznP6L[XLR8VrOMc6ً1x,{'<=[ܟGRuAy]As3iEBHºyAc„7iתm"AjbLdx#RŤc-y12aNmo/w-! >3nfYrLV ʇxz02HӴ+`v+ł{Z&ffJ[Ilz.O c@Bj0j['۳b 4!V7ɞ$wDbËxbO."r V@Z \%Ι0Mh{SyH] .kɔjB)q>1ÙLcex`Wy:3lxT >ԝs>QJ铄 Y8 }NͲPhW%C$V쩷q^ %Σ'˿Ȅ3MKq ܶ_0U W7Wt^ZBFxxc8Xߦ|EEKORyެC|D Q4o1ʄKDmy$*(Bx}m1[X4 [SD༑\y(r($ŠVC"}wj@`ᚱvPH`xA#t(vN|qOÚ`8ϒ'$f+a]db4F]u.tےYPCao;h}wNczUbUǶ<JQԏPDbv1XpP 0iՄ4b)m%2QbrߩH ㆃNߐ,B[s_q= <(T:-}W` &clY2>̉*[XKg,>qPօ:33hs曒nIuW#xԎp,}yl#>oi%UNhWƘ?>RI+}ЃlFkq#6˖ _e=# #dJ}O0kPB @eRcpd_7 $Ӎ ,:Fg{ss)@ U*aX+ 3Un"mBGi&1ELi.ɢ:PA Ug5TW;Y>ԗƠ7c g?9G]g!RGj3 4YvP{jMðOóN:Znr  G8jh2̠('91 YZ