resource-agents-3.9.5-46.el6$>(lHy`MoP@\Ձ>@?d  P" Nf    l 4& 58ӷBӿGHּI٤X`YlZڌ[ڐ\ژ]݀^bd8e=f@lBtXu@v(whxPy8jCresource-agents3.9.546.el6Open Source HA Reusable Cluster Resource ScriptsA set of scripts to interface with several services to operate in a High Availability environment for both Pacemaker and rgmanager service managers.Xc1bm.rdu2.centos.orgICentOSGPLv2+ and LGPLv2+CentOS BuildSystem System Environment/Basehttp://to.be.defined.com/linuxi686ccs_update_schema > /dev/null 2>&1 ||:("!U KMG# ##"a })u/F>%,)[U - 3.9.5-46Oyvind Albrigtsen - 3.9.5-43Oyvind Albrigtsen - 3.9.5-42Oyvind Albrigtsen - 3.9.5-41Oyvind Albrigtsen - 3.9.5-40Oyvind Albrigtsen - 3.9.5-38Oyvind Albrigtsen - 3.9.5-37Oyvind Albrigtsen - 3.9.5-36Oyvind Albrigtsen - 3.9.5-35Oyvind Albrigtsen - 3.9.5-34Oyvind Albrigtsen - 3.9.5-32Jan Pokorny - 3.9.5-31Oyvind Albrigtsen - 3.9.5-30Oyvind Albrigtsen - 3.9.5-29Oyvind Albrigtsen - 3.9.5-28Oyvind Albrigtsen - 3.9.5-27Oyvind Albrigtsen - 3.9.5-26Fabio M. Di Nitto - 3.9.5-25David Vossel - 3.9.5-24David Vossel - 3.9.5-23David Vossel - 3.9.5-22David Vossel - 3.9.5-21David Vossel - 3.9.5-20David Vossel - 3.9.5-19David Vossel - 3.9.5-18David Vossel - 3.9.5-17David Vossel - 3.9.5-16David Vossel - 3.9.5-15David Vossel - 3.9.5-14David Vossel - 3.9.5-13David Vossel - 3.9.5-12David Vossel - 3.9.5-11David Vossel - 3.9.5-10David Vossel - 3.9.5-9David Vossel - 3.9.5-8David Vossel - 3.9.5-7David Vossel - 3.9.5-6David Vossel - 3.9.5-5David Vossel - 3.9.5-4David Vossel - 3.9.5-3Fabio M. Di Nitto - 3.9.5-2David Vossel - 3.9.5-1David Vossel - 3.9.2-49David Vossel - 3.9.2-48David Vossel - 3.9.2-47David Vossel - 3.9.2-46David Vossel - 3.9.2-45David Vossel - 3.9.2-44David Vossel - 3.9.2-43David Vossel - 3.9.2-42David Vossel - 3.9.2-41Fabio M. Di Nitto - 3.9.2-40.3Fabio M. Di Nitto - 3.9.2-40.2David Vossel - 3.9.2-40David Vossel - 3.9.2-39David Vossel - 3.9.2-38David Vossel - 3.9.2-37David Vossel - 3.9.2-36David Vossel - 3.9.2-35David Vossel - 3.9.2-34Ryan McCabe - 3.9.2-33Ryan McCabe - 3.9.2-32David Vossel - 3.9.2-31David Vossel - 3.9.2-30David Vossel - 3.9.2-29David Vossel - 3.9.2-28David Vossel - 3.9.2-27David Vossel - 3.9.2-26David Vossel - 3.9.2-25David Vossel - 3.9.2-24Ryan McCabe - 3.9.2-23Ryan McCabe - 3.9.2-22Chris Feist - 3.9.2-21Chris Feist - 3.9.2-20Chris Feist - 3.9.2-19Chris Feist - 3.9.2-18Chris Feist - 3.9.2-17Chris Feist - 3.9.2-16Chris Feist - 3.9.2-15Chris Feist - 3.9.2-14Fabio M. Di Nitto - 3.9.2-13Chris Feist - 3.9.2-12Chris Feist - 3.9.2-11Chris Feist - 3.9.2-10Chris Feist - 3.9.2-9Chris Feist - 3.9.2-8Chris Feist - 3.9.2-7Chris Feist - 3.9.2-4Chris Feist - 3.9.2-3Chris Feist - 3.9.2-2Fabio M. Di Nitto - 3.9.2-1Chris Feist - 3.9.1-2Fabio M. Di Nitto - 3.0.12.1-1Lon Hohberger - Version: 3.0.12-22Lon Hohberger - Version: 3.0.12-21Fabio M. Di Nitto - 3.0.12-20Lon Hohberger - 3.0.12-19Marek Grac - 3.0.12-18Marek Grac - 3.0.12-17Lon Hohberger - Version: 3.0.12-16Marek Grac - 3.0.12-15Lon Hohberger - 3.0.12-14Lon Hohberger - 3.0.12-13Marek Grac - 3.0.12-12Lon Hohberger - 3.0.12-10Lon Hohberger - 3.0.12-9Lon Hohberger - 3.0.12-8Lon Hohberger - 3.0.12-7Lon Hohberger - 3.0.12-6Fabio M. Di Nitto - 3.0.12-5Andrew Beekhof - 3.0.12-4Andrew Beekhof - 3.0.12-3Fabio M. Di Nitto - 3.0.12-2Fabio M. Di Nitto - 3.0.12-1Fabio M. Di Nitto - 3.0.9-1Fabio M. Di Nitto - 3.0.7-5Marek Grac - 3.0.7-4Marek Grac - 3.0.7-3Fabio M. Di Nitto - 3.0.7-2Fabio M. Di Nitto - 3.0.7-1Andrew Beekhof - 3.0.6-2Fabio M. Di Nitto - 3.0.6-1Andrew Beekhof - 3.0.5-2Fabio M. Di Nitto - 3.0.5-1Andrew Beekhof - 3.0.4-2Fabio M. Di Nitto - 3.0.4-1Andrew Beekhof - 3.0.3-3Fabio M. Di Nitto - 3.0.3-1Fabio M. Di Nitto - 3.0.1-1Andrew Beekhof - 3.0.0-16Ville Skyttä - 3.0.0-15Fabio M. Di Nitto - 3.0.0-14Fedora Release Engineering - 3.0.0-13Fabio M. Di Nitto - 3.0.0-12Fabio M. Di Nitto - 3.0.0-11.rc4Fabio M. Di Nitto - 3.0.0-10.rc3Fabio M. Di Nitto - 3.0.0-9.rc2Fabio M. Di Nitto - 3.0.0-8.rc1Fabio M. Di Nitto - 3.0.0-7.beta1Fabio M. Di Nitto - 3.0.0-6.alpha7Fabio M. Di Nitto - 3.0.0-5.alpha6Fabio M. Di Nitto - 3.0.0-4.alpha5Fabio M. Di Nitto - 3.0.0-3.alpha5Fabio M. Di Nitto - 3.0.0-2.alpha4Fabio M. Di Nitto - 3.0.0-1.alpha4Fabio M. Di Nitto - 3.0.0-1.alpha3- LVM: fix for "partial vg activates when partial_activation=false" Resolves: rhbz#1332909- oracle: fix unable to start because of ORA-01081 Resolves: rhbz#1318240- exportfs: fix for IPv6 addresses Resolves: rhbz#1406843- portblock: create tickle_dir if it doesnt exist Resolves: rhbz#1327662- SAPHana/SAPHanaTopology: update to version 0.152.17 - Add netstat dependency Resolves: rhbz#1381891 Resolves: rhbz#1395594- Delay: change startdelay default to avoid timeout before starting Resolves: rhbz#1386187- lvm.sh: fix status clustered to check specific volume - netfs.sh: move defaults to metadata - nfsserver: use rpcpipefs_dir variable Resolves: rhbz#1320520 Resolves: rhbz#1286291 Resolves: rhbz#1382036- SAPDatabase: fix process count for SUSER - oracle: use monprofile parameter - send_arp: fix buffer overflow on infiniband devices - mysql: use replication_port variable - oracle: inform user that monprofile monuser must start with C## for container databases Resolves: rhbz#1260710 Resolves: rhbz#1358892 Resolves: rhbz#1351717 Resolves: rhbz#1337146 Resolves: rhbz#1374655- tickle_tcp: fix "Failed to open raw socket (Invalid argument)" issue Resolves: rhbz#1327662- rgmanager: fix .clumanager/statd ownership in fs.sh and clusterfs.sh Resolves: rhbz#1311963- Add portblock resource agent for Pacemaker - Add Oracle Data Guard resource agent for rgmanager Resolves: rhbz#1302545 Resolves: rhbz#1086838- Fix up for wrongly generated RNG schema for cluster configuration wrt. "action" tag Related: rhbz#1272587- Add migrate_options parameter to vm.sh Resolves: rhbz#1285921- Set VirtualDomain migrate_options default Resolves: rhbz#1286650- Use IPv6 DAD for collision detection in IPaddr2 - Add RAID segment type support for HA LVM - Fix Tomcat SELinux failed in enforcing mode - Add migrate_options parameter to VirtualDomain - Remove not-working tmpfs "support" from fs.sh - Fix tmpfile leak in mysql resource agent Resolves: rhbz#1276698 Resolves: rhbz#1266173 Resolves: rhbz#1280319 Resolves: rhbz#1286650 Resolves: rhbz#1024505 Resolves: rhbz#1292054- SAP HANA add Multiple Components One System (MCOS) support - sap_redhat_cluster_connector add support for "-" in hostnames Resolves: rhbz#1200903 Resolves: rhbz#1269897- Match exact Oracle SID to avoid waiting for 90 seconds and killing other databases if their names include the name of the database you're trying to stop - Use DAD to check for address collision instead of ping for IPv6 in rgmanager - MySQL wait up to "startup_wait" seconds for mysqld to create PID - Handle failure state during stop in orainstance.sh - Add Oracle resource agents for Pacemaker Resolves: rhbz#1200639 Resolves: rhbz#1191247 Resolves: rhbz#1207285 Resolves: rhbz#1234777 Resolves: rhbz#1070479- SAP Hana update to address several bugs Resolves: rhbz#1245730- Update addresses bug fixes for SAP Hana agents. Resolves: rhbz#1168251- Update addresses bug fixes for SAP Hana agents. Resolves: rhbz#1168251- Update SAP Hana agents. Resolves: rhbz#1168251- Place SAP Hana agents in sap-hana subpackage Resolves: rhbz#1168251- Preserves nfs sysconfig when using nfsserver agent. Resolves: rhbz#1179412- Introduce the nginx agent. Resolves: rhbz#1150655- SAP Hana agents. Resolves: rhbz#1168251- Fixes rgmanager lvm agent's ability to exclusively activate volume groups on nodes with aliases Resolves: rhbz#1085109- Fixes unreliable detection of nic device in IPaddr2 - Fix fs-lib.sh regression in is_alive write test failure detection - Fix properly handle mysql when alternate user is specified. Resolves: rhbz#1181187 Resolves: rhbz#1183735 Resolves: rhbz#1183148- Prevent oracle agents from failing on non critical errors Resolves: rhbz#1151379- For lv_by_vg, only strip tag on stop if we are owner. - NFS custom port config options - Fixes typo preventing passing "noload" or "data=..." mount options - Fixes undefined variable warning in fs-lib - Fixes mysql not stopped if data fs unavailable - Fixes postgres agent not detected correct user group - Handle nfs path ending in '/' correctly Resolves: rhbz#1161727 Resolves: rhbz#1096376 Resolves: rhbz#1096990 Resolves: rhbz#1134960 Resolves: rhbz#1150702 Resolves: rhbz#1159018 Resolves: rhbz#1173128- ip.sh now sends unsolicited advertisement packet for ipv6 Resolves: rhbz#1159805- Properly search for oracldb processes in oracledb.sh stop operations. Resolves: rhbz#960186- Updates required, unique, and primary fields in bind-mount.sh metadata Resolves: rhbz#1094789- Fixes bind-mount.sh metadata function. Resolves: rhbz#1094789- When signalling pids accessing a mount_point to exit, make sure to only signal each pid once. Resolves: rhbz#1089004- Revert accidental modification of exportfs's unlock_on_stop option. - Add on/off as valid value for ip.sh monitor_link Resolves: rhbz#1091102 Resolves: rhbz#1039119- Update force_unmount=safe option so it does not process duplicate process ids. Resolves: rhbz#1095943- Remove db2 exclude entries from spec file. Resolves: rhbz#1059981- Add support for pacemaker db2 agent - Fix syntax error in nfsserver.sh - Updates pacemaker nfs server agents. Adds support for nfsnotify agent. Resolves: rhbz#1059981 Resolves: rhbz#1091102 Resolves: rhbz#974239- Introduce passing ocft test cases. Resolves: rhbz#1023606- Fix usage of findmnt in fs-lib.sh based rgmanager agents. - When executing force kill of processes using a mountpoint, take into account those processes accessing shared memory. - Add force_unount=safe option to avoid blocking Filesystem agent during the stop operation. - Do not fail during stop if oracle listener is already down. - Correctly detect oracledb and orainstanch.sh shutdown. - Remove unused patches left over from before patches were consolidated into the new source files. Resolves: rhbz#1038474 Resolves: rhbz#1089004 Resolves: rhbz#1095943 Resolves: rhbz#1047999 Resolves: rhbz#960186 Resolves: rhbz#993431- Build sap package only on x86_64 Resolves: rhbz#1031601- Package cleanup. This change is a no-op. The heartbeat agents were updated to the 3.9.5 upstream release in this package months ago. The release number is now being incremented to reflect this. Resolves: rhbz#993431- Add iSCSILogicalUnit to rhel supported agents. Resolves: rhbz#1075000- Configurable startup_wait timeout for rgmanager's postgres-8.sh resource-agent - Allow non rhel builds to included unsupported agents. - Add bind-mount.sh rgmanager resource-agent. - Add 'statdport' option to nfsserver resource. Resolves: rhbz#1035380 Resolves: rhbz#1069621 Resolves: rhbz#1094789 Resolves: rhbz#918315- Allow vm.sh to monitor kvm domains without requiring libvirtd - Adds 'no_kill' option to vm.sh to prevent force killing vm during stop operation after timeout expires. Resolves: rhbz#853698 Resolves: rhbz#1079039- Updates the ocf:heartbeat:tomcat agent so it can be used in rhel6 with Pacemaker. Resolves: rhbz#1022792- Fixes unintentional removal of patch in previous build- New 'httpd' option for rgmanager apache.sh agent that allows custom httpd binary path to be set. - Fixes issue with pending sm-notify processes preventing nfs-server instances from stopping. - Fixes issue reported by coverity. - Fixes syntax error in some log error messages in the LVM agent - Optimize fs-lib based agent's monitor operation - Allow monitoring of kvm based virtual machines using the VirtualDomain agent without requiring libvirtd. - Allows named to run as user other than root. Resolves: rhbz#952132 Resolves: rhbz#974239 Resolves: rhbz#999537 Resolves: rhbz#1022277 Resolves: rhbz#1023099 Resolves: rhbz#1054327 Resolves: rhbz#1067023Add sec=krb5 as a valid nfsclient mount option Resolves: rhbz1019931- High: fs-lib.sh: Fixes failure to unmount local fs when process runs with cwd inside fs mount. Resolves: rhbz#1051115- Add no_unmount functionality back into netfs.sh agent - Use crm_node instead of uname -n when referencing cluster nodes. - Adds Delay agent back into package. - Drops nginx rsyslog mysql-proxy tomcat and slapd agents. Resolves: rhbz#993329 Resolves: rhbz#1023340 Resolves: rhbz#1028421 Resolves: rhbz#1022793- Fix netfs mount detection Resolves: rhbz#1027410- Fix netnfs unmount self_fence integration in netfs.sh - Ship send_ua helper binary to allow IPaddr2 to manage IPv6 addresses Resolves: rhbz#1027410 Resolves: rhbz#1027412- Advertises self_fence option in netfs.sh agent Resolves rhbz#1014298- Fixes issue with mysql agent not being able to set transient attributes on local node correctly. Resolves: rhbz#989284- Removes usage of fuser -kvm from fs-lib.sh based agents. This resolves issue with fuser blocking netfs mounts. - tomcat-6.sh, Do not fail on stop if config validation fails. - tomcat-6.sh, Set tomcat usr correctly. Resolves: rhbz#981717 Resolves: rhbz#983273 Resolves: rhbz#1014298- Fixes lvm metadata corruption caused when activating by lv using tags. Resolves: rhbz#1009772- Disables LVM exclusive activation via clvmd as it is not supported. Resolves: rhbz#989284- Fixes invalid return statement in LVM retry clvmd activation - Adds ability to disable findmnt to avoid autofs complications for fs-util based rgmanager agents. Resolves: rhbz#974941 Resolves: rhbz#989284- Use correct default config for heartbeat apache agent Resolves: rhbz#989284- Add support for setting TNS_ADMIN Resolves: rhbz#917807- Med: oracledb.sh: Fix process name grep in exit_idle Resolves: rhbz#853220- Fixes lvm agent unncessarily removing PVs/LVs when some PVs in VG fail. Resolves: rhbz#884326- Add correct nfs server defaults. Resolves: rhbz#989284- Add run-time dependencies for heartbeat agents. Resolves: rhbz#989284- Merge upstream heartbeat agents in for Pacemaker support. Resolves: rhbz#989284- Add missing sap agents to sap subpackage Resolves: rhbz#922838- Add sap connector script - Create SAP subpackage Resolves: rhbz#922838- fast filesystem mounts - properly handle NFS v4 mounts - fix uppercase ipv6 addresses - named transfer source options - fix restart postgres - fix honor self fence option - fix mount log level - fix wrong selinux context for nfs directory Resolves: rhbz#919231 Resolves: rhbz#851188 Resolves: rhbz#895075 Resolves: rhbz#711586 Resolves: rhbz#871659 Resolves: rhbz#908457 Resolves: rhbz#948730 Resolves: rhbz#959520- Fix: lvm: detection of clusternode with lvm using tags. Resolves: rhbz#976443- Med: oracledb.sh: Set RESTART_RETRIES back to 0 Resolves: rhbz#670022- Clean up Oracle resource agents and add support for Oracle 11g Resolves: rhbz#670022- Fixed missing '$' in lvm_by_vg.sh script - Retry VG shutdown to cope with udev collisions - Resolves: rhbz#729812- Update the rgmanager SAPInstance agent so resource limits configured in /usr/sap/services are properly applied. - Resolves: rhbz#869695- Better error messages for the script resource have been added to aid debugging - Resolves: rhbz#773478- SAPInstance and sapdb.sh were re-synced to the latest upstream versions - Resolves: rhbz#834293- HA LVM is now able to properly shutdown when device failures cause LVs to go missing which allows the service to migrate to another machine - Resolves: rhbz#860981- Add support for 'volume group per service HA-LVM support for RAID logical volumes' - Resolves: rhbz#824153- Fixes issue with rgmanager not recognizing a mounted cifs share due to trailing slashes - Resolves: rhbz#848642- Fixed issue causing fs.sh to fail when a device is still mounted - Fixed random servie failures when starting multiple HA LVM services - Tomcat resource now uses the proper defaults - The pacemaker SAPInstance and SAPDatabase resources were updated to their latest version - Updated lvm resource agent to not produce errors when used with pacemaker - oracledb.sh script now properly checks the status of the Oracle database - HA-LVM now supports RAID logical volumes - ip.sh now properly assignes the ip address to the correct interface on hosts with multiple interfaces on the same network - Stopping a filesystem when a device doesn't exist no longer results in failure - Log output from the 'status' action from netfs is now properly logged - In HA LVM clusters using tags, changing the lvm.conf file is now possible - Using rg_test with HA LVM resources no longer results in a "too many arguments" error - Resolves: rhbz#728365 rhbz#714156 rhbz#853249 rhbz#843049 rhbz#817550 rhbz#729812 rhbz#839181 rhbz#824153 rhbz#822244 rhbz#860328 rhbz#847335 rhbz#834293- Add nfsrestart option to fs and clustefs agents as last resource to umount the filesystem - Resolves: rhbz#822053- Fix for LVM HA agent for service relocation after leg failure (we now properly remove tag). - Resolves: rhbz#772773- In LVM HA agent, remove missing PVs before attempting to remove the tag - Rgmanager now properly detects when clvmd is not running when using HA LVM - vm.sh now supports a 'tunnelled' option - Resource agent script now have common directory set properly - Fixed apache resource agent configuration with IPv6 - fs-lib.sh now will now properly work with all return codes of mount - netfs now allows you to have the same NFS export mounted in different locations - The timeout in rhev-check has been increased to 90 seconds - Resolves: rhbz#772773 rhbz#729481 rhbz#712174 rhbz#784357 rhbz#742859 rhbz#728086 rhbz#799998 rhbz#727546- Fix to prevent /dev/shm being filled up by ocf_log debug messages - NFS client resource are now recovered properly when they are missing in /var/lib/nfs/etab - Resolves: rhbz#797922 rhbz#749713- More SAPDatabase updates to fix SAP workloads - Allow rgmanager SAP resource agent to manage SAP Webdispatcher & TREX - Resolves: rhbz#726500 rhbz#746996- Update SAPDatabase to more closely match upstream - Resolves: rhbz#784209- Require server_name in ASEHAagent to be unique - Resolves: rhbz#711852- Create a link for the modified dtd for rgmanager - Fix ocf-tester so rgmanager agents requiring bash don't cause syntax errors - Resolves: rhbz#727643- Main rgmanager resource agents now use proper return codes for use with pacemaker. - NFS mounts now unmount faster when the network is lost. - Resolves: rhbz#678497 rhbz#727643- Postgres-8 resource agent now properly detects if postgresql was started - fs.sh resource agent now returns the proper response code when a device does not yet exist. - Resolves: rhbz#709400 rhbz#694816- Rebase package on top of new upstream * ship xsl and rng files required to build relaxng schema * drop local copy of sfex_init.8 * drop bz711852-Fix-ASEHAagent-to-allow-for-multiple-ASEHA-agents-on.patch included upstream - spec file update: add %post to generate new relaxng schema Resolves: rhbz#707127- Fix ASEHAagent to allow for multiple ASEHA agents - Resolves: rhbz#711852- Rebase package on top of new upstream: resource-agents: Improve LD_LIBRARY_PATH handling by SAP* resource-agents: Add resource type to logging oracledb.sh resource script should attempt a clean shutdown first resource-agent does not remove nfs service temp dirs when using nfslock=1 Listen line in generated httpd.conf incorrect Include rhev-check upstream - spec file update: * drop all patches * resync with upstream spec file. See top section for local deltas Resolves: rhbz#707127, rhbz#705763, rhbz#667217 - Move rgmanager S/Lang from resource-agents to rgmanager: * Add versioned Conflicts on rgmanager to avoid file conflicts Resolves: rhbz#693518- resource-agents: Fix nfs mount contexts (fix_nfs_mount_contexts.patch) Resolves: rhbz#635828- Mirror dev failure in HA LVM can cause service failur (fix_bug_683213_mirror_dev_failure_in_ha_lvm_can_cause_service_failure.patch) Resolves: rhbz#683213- resource-agents: fs-lib: fix do_monitor device mapping (fs_lib_fix_do_monitor_device_mapping.patch) Resolves: rhbz#669832- resource-agents: Add multi-instance Oracle database agents (add_multi_instance_oracle_database_agents.patch) Resolves: rhbz#629275 - resource-agents: Stop using '-' as 1st char of log messages (stop_using_as_1st_char_of_log_messages.patch) Resolves: rhbz#633856 - resource-agents: Use literal quotes for tr calls (use_literal_quotes_for_tr_calls.patch) Resolves: rhbz#639252 - resource-agents: Fix migrateuriopt setting (fix_migrateuriopt_setting.patch) Resolves: rhbz#660337 - resource-agents: Support convalesce w/ central_processing (support_convalesce_w_central_processing.patch) rgmanager: Add failure tolerances to resources.rng (add_failure_tolerances_to_resources_rng.patch) Resolves: rhbz#674710- Disable updates to static routes by RHCS IP tooling (resource-agents-Add-option-disable_rdisc-to-ip.sh.patch) Resolves: rhbz#621538- fix resource agent for named (resource-agents-fix-resource-agent-for-named.patch) Resolves: rhbz#648897- resource-agents: fix utility to obtain data from ccs_tool (fix_utility_to_obtain_data_from_ccs_tool.patch) Resolves: rhbz#631943- postgresql RA does not work correctly with netmask (psql_does_not_work_correctly_with_netmask.patch) Resolves: rhbz#614457- resource-agents: Drop tomcat-5 from build (drop_tomcat_5_from_build.patch) Resolves: rhbz#593721- Allow other values for "yes" in fs-lib when unmounting file systems (fs-lib_allow_other_values_for_yes.patch) Resolves: rhbz#614421- postgres RA will fail to stop gracefully if there is active client connected (sigquit_if_sigterm_was_not_fast_enough.patch) Resolves: rhbz#612165 - new RA for tomcat6 (resource_agent_tomcat-6.patch) (tomcat-6_change_build_system.patch) Resolves: rhbz#593721- Fix changelog for 3.0.12-9 date - Add RHEVM status program (add_rhevm_status_program.patch) Resolves: rhbz#609497- Add NFSv4 server support (add_nfsv4_support.patch) (install_nfsv4_agent.patch) Resolves: rhbz#595547 - Fix migration mapping behavior (fix_migration_mapping_behavior.patch) Resolves: rhbz#596918- Make fs-lib resolve links before checking for block devices (fix_incorrect_link_resolution_in_fs_lib.patch) Resolves: rhbz#609579- Make vm.sh honor start and stop timeouts (Make_vm.sh_use_stop_start_timeouts.patch) Resolves: rhbz#606754- Add missing documentation for resource agents (add_missing_resource_docs.patch) - Clean up recursion in scheman output and documentation (clean_up_recursion_and_documentation.patch) Resolves: rhbz#606470- Fix incorrect default for VM.sh agent (resolve_incorrect_default_for_vm_agent.patch) Resolves: rhbz#599643- Add missing man pages (Add Source2: ocf-tester.8 and Source3: sfex_init.8) Resolves: rhbz#594332- Do not package ldirectord on RHEL Resolves: rhbz#577264- Drop Requires on xfsprogs since package moved to another channel Resolves: rhbz#593433 - Fix HALVM: lvm agent incorrectly reports vg is in volume_list (halvm_lvm_agent_incorrectly_reports_vg_in_volume_list.patch) Resolves: rhvz#593108- Rebase on top of new upstream bug fix only release: * drop all bug fix patches. * refresh patches with official SHA1 git commits from RHEL6 upstream branch: - drop_support_for_drbd_and_smb.patch * Addresses the follwing issues: from 3.0.12 release: Resolves: rhbz#582754, rhbz#582753, rhbz#585217, rhbz#583789 * Rebase: Resolves: rhbz#582353 - Stop build on ppc and ppc64. Resolves: rhbz#590997 - Switch to file based Requires. Also address several other problems related to missing runtime components in different agents. With the current Requires: set, we guarantee all basic functionalities out of the box for lvm/fs/clusterfs/netfs/networking. Resolves: rhbz#584800 - New pacemaker agents upstream release * Patched build process to correctly generate ldirectord man page + High: pgsql: properly implement pghost parameter + High: RA: mysql: fix syntax error + High: SAPInstance RA: do not rely on op target rc when monitoring clones (lf#2371) + High: set the HA_RSCTMP directory to /var/run/resource-agents (lf#2378) + High: RA: vmware: fix set_environment() invocation (LF 2342) + High: RA: vmware: update to version 0.2 + Medium: IPaddr/IPaddr2: add a description of the assumption in meta-data + Medium: IPaddr: return the correct code if interface delete failed + Medium: nfsserver: rpc.statd as the notify cmd does not work with -v (thanks to Carl Lewis) + Medium: oracle: reduce output from sqlplus to the last line for queries (bnc#567815) + Medium: pgsql: implement "config" parameter + Medium: RA: iSCSITarget: follow changed IET access policy + Medium: Filesystem: prefer /proc/mounts to /etc/mtab for non-bind mounts (lf#2388) + Medium: IPaddr2: don't bring the interface down on stop (thanks to Lars Ellenberg) + Medium: IPsrcaddr: modify the interface route (lf#2367) + Medium: ldirectord: Allow multiple email addresses (LF 2168) + Medium: ldirectord: fix setting defaults for configfile and ldirectord (lf#2328) + Medium: meta-data: improve timeouts in most resource agents + Medium: nfsserver: use default values (lf#2321) + Medium: ocf-shellfuncs: don't log but print to stderr if connected to a terminal + Medium: ocf-shellfuncs: don't output to stderr if using syslog + Medium: oracle/oralsnr: improve exit codes if the environment isn't valid + Medium: RA: iSCSILogicalUnit: fix monitor for STGT + Medium: RA: make sure that OCF_RESKEY_CRM_meta_interval is always defined (LF 2284) + Medium: RA: ManageRAID: require bash + Medium: RA: ManageRAID: require bash + Medium: RA: VirtualDomain: bail out early if config file can't be read during probe (Novell 593988) + Medium: RA: VirtualDomain: fix incorrect use of __OCF_ACTION + Medium: RA: VirtualDomain: improve error messages + Medium: RA: VirtualDomain: spin on define until we definitely have a domain name + Medium: Route: add route table parameter (lf#2335) + Medium: sfex: don't use pid file (lf#2363,bnc#585416) + Medium: sfex: exit with success on stop if sfex has never been started (bnc#585416)- new upstream release Resolves: rhbz#569959 - spec file update: * update spec file copyright date * use bz2 tarball- Resolves: rhbz#568010 - Do not build resource-agents on s390 and s390x.- Checksum error occurs on HA-LVM - status on clusterfs "gfs" returned 1 (generic error) - Resolves rhbz#563555 rhbz#558664- resource-agents can't be used by Pacemaker - Resolves: rhbz#566176- Drop support for drbd and smb (PM-drop-support-for-drbd-and-smb-resource-agents.patch) - Explicitly list python as BuildRequires- New rgmanager resource agents upstream release- Update Pacameker agents to upstream version: c76b4a6eb576 + High: RA: VirtualDomain: fix forceful stop (LF 2283) + High: apache: monitor operation of depth 10 for web applications (LF 2234) + Medium: IPaddr2: CLUSTERIP/iptables rule not always inserted on failed monitor (LF 2281) + Medium: RA: Route: improve validate (LF 2232) + Medium: mark obsolete RAs as deprecated (LF 2244) + Medium: mysql: escalate stop to KILL if regular shutdown doesn't work- New rgmanager resource agents upstream release - spec file update: * use global instead of define * use new Source0 url * use resource-agents macro more aggressively- Update Pacameker agents to upstream version: bc00c0b065d9 + High: RA: introduce OCF_FUNCTIONS_DIR, allow it to be overridden (LF2239) + High: doc: add man pages for all RAs (LF2237) + High: syslog-ng: new RA + High: vmware: make meta-data work and several cleanups (LF 2212) + Medium: .ocf-shellfuncs: add ocf_is_probe function + Medium: Dev: make RAs executable (LF2239) + Medium: IPv6addr: ifdef out the ip offset hack for libnet v1.1.4 (LF 2034) + Medium: add mercurial repository version information to .ocf-shellfuncs + Medium: build: add perl-MailTools runtime dependency to ldirectord package (LF 1469) + Medium: iSCSITarget, iSCSILogicalUnit: support LIO + Medium: nfsserver: use check_binary properly in validate (LF 2211) + Medium: nfsserver: validate should not check if nfs_shared_infodir exists (thanks to eelco@procolix.com) (LF 2219) + Medium: oracle/oralsnr: export variables properly + Medium: pgsql: remove the previous backup_label if it exists + Medium: postfix: fix double stop (thanks to Dinh N. Quoc) + RA: LVM: Make monitor operation quiet in logs (bnc#546353) + RA: Xen: Remove instance_attribute "allow_migrate" (bnc#539968) + ldirectord: OCF agent: overhaul- New rgmanager resource agents upstream release- Update Pacameker agents to upstream version: e2338892f59f + High: send_arp - turn on unsolicited mode for compatibilty with the libnet version's exit codes + High: Trap sigterm for compatibility with the libnet version of send_arp + Medium: Bug - lf#2147: IPaddr2: behave if the interface is down + Medium: IPv6addr: recognize network masks properly + Medium: RA: VirtualDomain: avoid needlessly invoking "virsh define"- New rgmanager resource agents upstream release- Update Pacameker agents to upstream version: 099c0e5d80db + Add the ha_parameter function back into .ocf-shellfuncs. + Bug bnc#534803 - Provide a default for MAILCMD + Fix use of undefined macro @HA_NOARCHDATAHBDIR@ + High (LF 2138): IPsrcaddr: replace 0/0 with proper ip prefix (thanks to Michael Ricordeau and Michael Schwartzkopff) + Import shellfuncs from heartbeat as badly written RAs use it + Medium (LF 2173): nfsserver: exit properly in nfsserver_validate + Medium: RA: Filesystem: implement monitor operation + Medium: RA: VirtualDomain: loop on status if libvirtd is unreachable + Medium: RA: VirtualDomain: loop on status if libvirtd is unreachable (addendum) + Medium: RA: iSCSILogicalUnit: use a 16-byte default SCSI ID + Medium: RA: iSCSITarget: be more persistent deleting targets on stop + Medium: RA: portblock: add per-IP filtering capability + Medium: mysql-proxy: log_level and keepalive parameters + Medium: oracle: drop spurious output from sqlplus + RA: Filesystem: allow configuring smbfs mounts as clones- New rgmanager resource agents upstream release- New rgmanager resource agents upstream release- Create an ldirectord package - Update Pacameker agents to upstream version: 2198dc90bec4 + Build: Import ldirectord. + Ensure HA_VARRUNDIR has a value to substitute + High: Add findif tool (mandatory for IPaddr/IPaddr2) + High: IPv6addr: new nic and cidr_netmask parameters + High: postfix: new resource agent + Include license information + Low (LF 2159): Squid: make the regexp match more precisely output of netstat + Low: configure: Fix package name. + Low: ldirectord: add dependency on $remote_fs. + Low: ldirectord: add mandatory required header to init script. + Medium (LF 2165): IPaddr2: remove all colons from the mac address before passing it to send_arp + Medium: VirtualDomain: destroy domain shortly before timeout expiry + Medium: shellfuncs: Make the mktemp wrappers work. + Remove references to Echo function + Remove references to heartbeat shellfuncs. + Remove useless path lookups + findif: actually include the right header. Simplify configure. + ldirectord: Remove superfluous configure artifact. + ocf-tester: Fix package reference and path to DTD.- Use bzipped upstream hg tarball.- Merge Pacemaker cluster resource agents: * Add Source1. * Drop noarch. We have real binaries now. * Update BuildRequires. * Update all relevant prep/build/install/files/description sections.- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- spec file updates: * Update copyright header * final release.. undefine alphatag- New upstream release.- New upstream release.- New upstream release + git94df30ca63e49afb1e8aeede65df8a3e5bcd0970- New upstream release. - Update BuildRoot usage to preferred versions/names- New upstream release.- New upstream release.- New upstream release.- Drop Conflicts with rgmanager.- New upstream release.- Add comments on how to build this package.- New upstream release. - Fix datadir/cluster directory ownership.- Initial packaging/bin/shheartbeat-resources "%&+./036?HMT]`cdehily|}~&/2567:;>KLMNOPQRUV[dgqrstuvwxyz{|}~3.9.53.9.5-46.el63.9.5-46.el6 3.9.5  ha.dshellfuncsheartbeatagent_config.hocflibheartbeatapache-conf.shfindif.shhttp-mon.shocf-binariesocf-directoriesocf-rarunocf-returncodesocf-shellfuncsora-common.shresource.dheartbeat.ocf-binaries.ocf-directories.ocf-returncodes.ocf-shellfuncsCTDBDelayDummyFilesystemIPaddrIPaddr2IPsrcaddrLVMMailToRouteSendArpSquidVirtualDomainXinetdapacheconntrackddb2dhcpdethmonitorexportfsiSCSILogicalUnitmysqlnamednfsnotifynfsservernginxoracleoralsnrpgsqlportblockpostfixrsyncdsymlinktomcatheartbeatfindifsend_arpsend_uatickle_tcpocftrhev-check.shclusterASEHAagent.shSAPDatabaseSAPInstanceapache.metadataapache.shbind-mount.shclusterfs.shfs.ship.shlvm.metadatalvm.shlvm_by_lv.shlvm_by_vg.shmysql.metadatamysql.shnamed.metadatanamed.shnetfs.shnfsclient.shnfsexport.shnfsserver.shocf-shellfuncsopenldap.metadataopenldap.shoracledb.shoradg.metadataoradg.shorainstance.metadataorainstance.shoralistener.metadataoralistener.shpostgres-8.metadatapostgres-8.shrelaxngra-api-1-modified.dtdra2man.xslra2ref.xslra2rng.xslresources.rng.headresources.rng.midresources.rng.tailsamba.metadatasamba.shscript.shservice.shsvclib_nfslocktomcat-6.metadatatomcat-6.shutilsconfig-utils.shfs-lib.shhttpd-parse-config.plmember_util.shmessages.shnamed-parse-config.plra-skelet.shtomcat-parse-config.plvm.shresource-agents-3.9.5AUTHORSCOPYINGCOPYING.GPLv3ChangeLogREADME.webappsocf_heartbeat_CTDB.7.gzocf_heartbeat_Delay.7.gzocf_heartbeat_Dummy.7.gzocf_heartbeat_Filesystem.7.gzocf_heartbeat_IPaddr2.7.gzocf_heartbeat_IPsrcaddr.7.gzocf_heartbeat_LVM.7.gzocf_heartbeat_MailTo.7.gzocf_heartbeat_Route.7.gzocf_heartbeat_SendArp.7.gzocf_heartbeat_Squid.7.gzocf_heartbeat_VirtualDomain.7.gzocf_heartbeat_Xinetd.7.gzocf_heartbeat_apache.7.gzocf_heartbeat_conntrackd.7.gzocf_heartbeat_db2.7.gzocf_heartbeat_dhcpd.7.gzocf_heartbeat_ethmonitor.7.gzocf_heartbeat_exportfs.7.gzocf_heartbeat_iSCSILogicalUnit.7.gzocf_heartbeat_mysql.7.gzocf_heartbeat_named.7.gzocf_heartbeat_nfsnotify.7.gzocf_heartbeat_nfsserver.7.gzocf_heartbeat_nginx.7.gzocf_heartbeat_oracle.7.gzocf_heartbeat_oralsnr.7.gzocf_heartbeat_pgsql.7.gzocf_heartbeat_portblock.7.gzocf_heartbeat_postfix.7.gzocf_heartbeat_rsyncd.7.gzocf_heartbeat_symlink.7.gzocf_heartbeat_tomcat.7.gzresource-agentsocftREADMEREADME.zh_CNcaselibconfigsFilesystemIPaddr2IPaddr2v4IPaddr2v6IPsrcaddrLVMMailToSendArpXinetdapachemysqlnamednfsserverpgsqlpostfixtomcatra-api-1-modified.dtdra-api-1.dtdresource-agents/etc//etc/ha.d//usr/include//usr/include/heartbeat//usr/lib//usr/lib/ocf//usr/lib/ocf/lib//usr/lib/ocf/lib/heartbeat//usr/lib/ocf/resource.d//usr/lib/ocf/resource.d/heartbeat//usr/libexec//usr/libexec/heartbeat//usr/sbin//usr/share//usr/share/cluster//usr/share/cluster/relaxng//usr/share/cluster/utils//usr/share/doc//usr/share/doc/resource-agents-3.9.5//usr/share/man/man7//usr/share/resource-agents//usr/share/resource-agents/ocft//usr/share/resource-agents/ocft/configs//var/run/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -march=i686 -mtune=atom -fasynchronous-unwind-tablesdrpmxz2i686-redhat-linux-gnu              ASCII textBourne-Again shell script text executableELF 32-bit LSB executable, Intel 80386, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.18, strippedPOSIX shell script text executableUTF-8 Unicode textXML 1.0 document texta /usr/bin/perl -w script text executablebroken symbolic link to `/usr/lib/ocf/resource.d/heartbeat/IPaddr2'broken symbolic link to `/usr/share/cluster/relaxng/ra-api-1-modified.dtd'directoryexported SGML document textsticky directorysymbolic link to `../../lib/heartbeat/ocf-binaries'symbolic link to `../../lib/heartbeat/ocf-directories'symbolic link to `../../lib/heartbeat/ocf-returncodes'symbolic link to `../../lib/heartbeat/ocf-shellfuncs'troff or preprocessor input texttroff or preprocessor input text (gzip compressed data, from Unix, max compression)  !)18?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`bcdfgiR R R R R R R R R R RR R R RR R R R RR R RR R R R R R R R R R R"R#R$R%R&R'R(R/R"R#R$R%R&R'R(R/R"R#R$R&R'R(R/R"R#R$R&R'R(R/RR RR R RRRRRRRRRRRRRRRRRRRRRRRRRRRRRR)RRRR)RRR)R?7zXZ !PH6_o]"k%UIj?0:g/}DJGL+#ev-Mod(a'<ߕpZՁm^tc ,csRb!Ӽ ]U(dBfGp674'Z+<Ȭ'-DY/V81vG-RIR^6Ǚ8ޔPF=n`.B}GVR5 }F.">>'8f) L7Z58eARhBL=@j<v]:!n:tGc5 \Th,zteR~$UMD)ܸT19d,,a j߼9#;Sȣ".[6fz|ʩkqvCx-$NB3p4-G)eZNֈlai= ?%tDEy^"@DN2,YY=EoauLSgl}*ulJMr!Hf?PC|ɳksm}y &J,sx$Vg4 tX+[gV1_b ~m\^hI4:҉Inm W-NذmeԼ@PB_'$&|;)[1.io9Fi@9bTVR[ K?B*,k &4 nu$_+s/&,KQ F/w~hL;-0ͺ=9ִ+{7DH):%&c~Ҧ@ц: qk}q1Wz83>h,PpToDix+3ZJ)&V4!_aq-S '{!![ Dl#"I@pvOEv۳C!}T9 VK)\,8ۮ Ck%y O8+xHEN$.dp)_^q" (U&@W9Jȅ*+1u9a1}g> gIbr3\ᥐݖm]3^Ҿ 4 ^;c{xAXh>ץ7P#p__'Top9Ը9 5 ~Mt(>\7"d37~c~n)ctu ŊKX)K:sFݱ$!ApZ-tw wcyP\o/ oBWվr5}9ý6I[ cU?\9~SA V~0MRB?X rPDFJB:ۃGk{*d<ho^ajXޚz2Ic$ˡ{JIKa>!fMѻl+D5X_ :|==+׶Zt\qx(i2ëVNxPW~HZqنH 92qf3ճH9g3@|3u :YYq3}^i ~!}OضST3GHP}1iUKSn:~b~^VnC4wf5 QtC~߶PllR̴P~6<ҡ)Iai*yOa=UtVǛi':C?vݳqP SN!%MG$gl,Fe X@b1Bbc aF;,tg/hAR@@ 'c1zd@ J:cؖ#SB~S?l[9ZؔC%?<}EÆMTy܊ReslHF\hHw/lCF6J u/Qn?7]5.vJӹ , lJ{xGgLa؎tDBF&S=%R@x+K&nD]{dheadFKNnLx.*veM_ݩVЛ7KUwQjPU:Ts[_VoxQZgsvq ~K$ GPd˒/upő:3?{?V8pYFE?J 2L)ǫ+#c`:V+1 <̊dDm )EMLyaMLѠfpIxUn*0T+dz3R~v颤A:lui)~{bj/;N*whYƵlz$d H(~IOMR=;3>b1aX V炲\d1ƾnmzH >=Li.wV*TٞuhC OaY%u7u ÐR&dxABS#)^G#RusxR9὿̛Uoasj7PmQ|?i="@MB"onSae`H3>ܫ+AGnhh6 KS?FLGRIB--j.[u%As[h`ZM]pO*B)mzE $ڷ7ڝ֒h'L*4P{>V,F ɾ;Q)jQY:4'K&tQݫV6[:b|?K:m E1 J< i|n76'KC+-2x@on!X灉*tLGpfBaD?G׀iUBKF: RZ$~c#TgJ?5"e`Ҏ$):loa~J&`[jkJ/vJT{k>Cv{,I:Y w׺%"[~5}P~`'sk#9!W/H~+YeFb.=PTT|7AZZJ|_xzNӘ獢Nэ Z"mo!%Ӓ[u*{|~a1xbBh-jPCѤ[f , Bp=;ս&pB5YPRN)KQEr } ⇜HtFM|e j/ w \Z"ӿ5%^=v33l5n [VFuyސrњeU5A 8CQ{1`јy)߷Ymc^v0/wx̔*=s,21?Uun~+Tsg`2mڽ;~Oݯ.X;ct/>&H@#|)UmuL7yijqa.y.΃VSvc 4'd(`A)S:mwl# g\u77Ѧs?>Xh+6*Smk={P RCZ^|{& N~22\DIX *Td*Bm"%přթ{kD{3>C7ּ C1W؉8V_irwبrlz.b3 ʓ=9>΀jwό\b&Guv8%b]cčE:K¯BkaQfvQ3AɛqR' eKK2H2PReM;FC^.pނ̳E]^c7LF4--f\!(Ns4GÓ_2y1+}dgIȊLH$ane]Gxy  ;Won?llO^} R~g}p)"1<9σW.+H pVfK$-P~)$+ Ԍjg+"fp)XR[3&STZM88Ď:kx /"h|SO|"y!rKPsA<b>dT'"!sbk yk)9pHJ{_VAg4wW˅~9VϐFY@Chm]7zgusN3s.L(1[?o-K(vњ.Knz֓T%,X2:է#ȟ:/Ez +[4`ޏVf(Xab$3{Xv!E=_Zg g/;/qQJnGA^8}fV loU;_Sz5tKZ8ג͛X~3[>SD9Z~ +Lfpa?[a-lNrL5fj@iLu/Pb w\w#%Ekg`9hSwP6S/ר`ظrczLy5cul?>Ę1Ĵ`k?s KEt~4WyP|[j -CUb'1/i73gͨC>FErɍp!U`K6w vTF94ɬt"&YL\,le"U↔adC !ElWCQmIO+/"T[rZ7VdUѵ ()xJ]P+>:mԍ,n vé ۇl aǒ;F +'1W29)Ӕ\|c5!2Υ*.ηhO6.'zNQUbl#'X!5bhKw#$CFgw)#q1 Ӻg~:E1c}ɽhɤ&oey*Q$i:C\Сe`kg :f9߷bV~/2fgن ;*f{qmBq &.A0|#-ҢU<^9eQBf!=2LE'nz% ϜQV,*RLGQl¨AP9@9p. A <VC8p8=-mxd/}di/qT,KM"Ga!qHHj˵6x*C{[ZǫOQU- *UńM}C+jWxI諁ZO `uF9Vnu&-mF3)J,\;s~i߅w-Y4gKЂ]Kۣh[/ kZ%TUX g8%?0<`6 z1ȑ{'DYX%trhge`)9sƘH]p3{;% /mZrY,6fXwd2m7p)M ALa; *"IT6iFOmj/~ 9JF7<)KnK.̫.c('?ȩ:<r/9„PR- 4~7Ҿp)HHxe(R|gs*E0ŲG\)|*bہ0>XIuBAE3Ykʫ_<̦y8=LjӮcOo$zP]:k%(;Xv\-7'=F7F ]1xrCb鷵-?r}buDH@A!HO*.VndFt;ܮ~·8FU']xEU{lC;3\GH{@IB[f]1wRyo{+;]x۾v8r,1ݴ0(|ǹ7ehh彙{5AL;_׳uCUQԤ@O4Z=aϫDb qz`aZeqRZ+OC (Tڿ䴏Q@ fGhOI=t*1}YŁb3.Pod_38iKAk~UOrq f'1;AV^0MQ:7o6S5.$1&N"Fx0<8Yٓ3pӶ%J1"[y޲Ų5a.#) )łr+ίfś$=Գ+x h+v*ͭ;w'qΈ"eXO%?Fݬ' FѬ? B\RfF/BX8 ʖ(di|jx㼈_lXd>Zq>@`Bw|V<*\[IQ :6bYK$k:$uRHO9#qtt>rl*i(oF㻐Lu Oò5+|lx/%]V~؝dT؂:/k͈úynX,*?j{JҩVҺҺE39s?3ܮ NNSsT2RmZ cc5g,Evtys\TA2voh1m-icd(L ~bp`f͙5fѸopOIjGC?nG A{ҎED>գsVϷ o_:4d7R>p!",Ң@ӎ GNo~RխԞ1bn*$W ,v2sr:$#%X i U#^AyD7YcUmYzHXPh2ts8 צ2[5v֊!Ohr# 8hbÛS<~ɒӷx,\\d!i?W PTR!s'z\9vbD7,e&)4vеؠv/Z"'vMHE9fFC*=/-1t2J̩,`^~D0zE]kB%/b'Tq0rX|P@ZsΥ8냰f!&NBG>=B h]3$ ip%bzwYz~4, _*,sr#G,IQ貕G#"=.76_̚P< cp`V=Cxӱ5(ה̘^GWMeaI r/" _]y#gLy.EDaOUh2/A@=h zŴ;ۋ0.!3NwY;?(= 5`>P8.zV2'n8RpRN[de} >@I⟊^ܑlOo'Kp%jB'LQ`3x,Z2Uήs, Io;{IBXd͍*1I%Kezd؎"v~#Ar/Nπ3qDO+݅>wj) -+U]Qb ( E1kaΪ"!XVb)0#Q^hNs޶S;9/PfjF60DG &B2N #&-k4,5ˁ$< &k7ed<6vr`dt މ0V6J`OD;ϭ_5$nL:h\Z(jjDG1Ylь^r7Bw$g^kQ綾5>+j( B@O{S&(xt#/n&[0G|z j_8G|,.F [5]gFإ^E@` R! u#@y) \JPceɼ< xK[d~9Lžj\ Y8I\$l(V9#fp驗-n=%X-ՏQ]*:B't<446xͮ  T ig*xcTGjR}Eʪj5Uί o[汢&Źti'MaqY%jYP)s?R t^'tՊb ]8F8xs/:|(0tm3C? 6}]=j+&H[KwKR}pkQ?߀[-ɒUxCPM몌ȷ?ְ'eҁSB srɃZ%'6ʫyu\^RWVI>?SilGZGz^ONM@ҞڼOAx4 >ˆ̙w) vhU }]R'lAz1BF~qWeɣF>m,CGj3}a5R_wɜiYj.W3tWb: Q|DSFzJ`2e1 AAu@I.ju=qи wh.## n靰a$}שZ,E-P}bzc660+,g?|lrb@Kt`[ fTڂZ#7enLxI}ؗ!Cw-4㸗o0$81݄E7ouօ3kϥ_hTS0Ĉ()eisϫ!G<`ѩI ʫG2?e~nH=+[YMOY., ݈JO~’fTZҸPT\I0^yJ$(9eNoBV )ILJS_TXQm+SB]jXnh qF0%hwsYF723䳬As^YNdJ[Ԇ l l+pE-ВuN_`bl+#̖%X@{gL^ Yx/cݭCr=W*T3ﾆo嚣7sS:~f1('碼4ԫhQ`]H# . )%zCrk[7PRYw;3e41 Z82;B/x$}[GAI`tV}L%Qb. qaeO1Bua|Q"+ErkbG\C{Z@C+MO O>MdK~/naίLY*UcOaH$M:H_ߍ[jxAx *&UbR'nжHR7 E'QS%c1㘣kϲs@qMQ\im6ўph+\e]eXWܷBљ[:/yszvPbiݍbtc CUKB;N7@)jqf)F5ϴnqm+ Ӓ:,'ƇAhaj&V{,n<-f;J0N{ nbxwEfbduuK9܉ =q4ԛO+qpmy[QձoqUkIQۂdU_IZa]f&GݢcZ*w*ZBVbrgĒ$fsض5`OvmQ nh+~Czd2 ?MNx4́_[k!%1sF5;Qپ{ gKlg#O[SxH(Vd>>sr 2@Mޓ~ =d,ljx$;a0ϙ6}NDfFnuİ5DAMK[V4X ŝ&m)!?hFқ隴sj{#t_*jtyjiOXDyE7AyˍЋrQbUCۀ'XFƕv_ފqNҷx}sҙ<#gc}z0W5E gk0ULƝĮ{y=P̶݇Lz .S>K֍eEZ %>nkͤU'=6>Sp|EN7^qѣ&H*w9ȃp{^Z(d[۳rkNcP!s^`gJJ\v3FpbЬKD2D}hd@|0M)f1Ĉs1;ߋ!VňN E.#~U9<,Q͑"맊'%-Օ;irYĤT_#\ЁzAGf^^dwſ^7 U@PԹo/+3$ @(4s 5Y)G}\>xE$B'c˔l"8?:Q\1xtT\=ir/o̡MUm"${XpĽ18(A'h_o-} 1-嚐t9ppƖW֤."A;`Oi.1 lNǪȎ-Op#y2_M6,L烔7퀮3 2i"JioH+ T!Qş*LAy=޷?" ƛAaedW@GxvKB>]v+!RӋJǀ"j<#I\HM53aSܕmV}p6 ݽU+#r =)Ely)l&y ^&[k_IW G)/azr?;ֹ\ M/Ӥ2 'pR}rʶ$Tl{K&MǧG$U$wop߄ʞ]=򈞚22艈u/U\ĪŭjT 7B]qčwI|jY%c{EsgPŗ՟|0LnZcn0fI¹gKDMz.fNFhnӆnHN-̩9踽!<)ź$qS c.5.9ɀ-Sd˲v֥j=W͌C /i+fęeXm,'lZGǬ4Y/)jWi%7 %enpOmtC0^)PA~z ?Τ:7V,@bgr"!>G='&&DJsF#d s(ݗ$iRں֣/<>+X #ǢjrFhhO]KVWg=aOR)j `)#땰PV$G{?wrV'+#ȴ-ˑ.A)Enn#De8;aAHE$M sfby锱|zAR-)r02)K0D,}]_*=w#rn :鷨$"z04zoo\a׃P*{ [߼01;n\r 0B-IFQ%GP\;9EWߗo RtC)v~`.Ds) #=aJw PPK]r"YW%T^v@F +_Q}'LN;4Y4QKE<' 3[dJ5$HRI_9u&[/Nb@k$A.axumĕsX:Υ`{W~~IE+1tQW(q_K4?MDsIϻ_6kC 6 WQ-tDy6ogY.WQF-9tbp Ng=<%fi+IBiT HXbx~"\R=B4F9X*֜]ܢ)B8 moDBlf*6 5~YLO .i<kdcfȀQC[(ˡ$Ikknd1G8i#yQm@5ih\@(X&_)ZIET4@|ƃcxP ud(l7 &-͇ z])fGOi ۆГOͰB~?vMd"߉/I(uD[y{1(Bfy=+Zm8s^9f/kœ pwz ؘ),GbL@K#(T):MFL9^Tko6ALJ&rL[ќaq>Hlx c#֨#hxažzªN"vֽ}*PgVCѕ4`~  x9N@~XK QࢽCh9pEF$kAr8vr;Eԃ>41@H>I,BA0+q&ҳKҾbUy?].wߣ-wc͔O]mpO3u\ԶwHqJ_.[)((ZBr¶$o<0\].(l- 䘂Pdhtȷ57?:!^5m1Qǘ Ȁl9XD ~MŌzRqe׀O taC58@CSuC=7NOaoD{!á7Ĵ|8aK;U6.4H<dzW 4e{ѻK̵]{"\OF*E_A.N;ýi*5Z'5i2Ha(+[SPiLpkxwEρ'm 00O#1nPNj9S@cFs\Nmŵ8 q/|d wxB oaBU GM@iNJZ\ GRbAOPH"h'[?R 7հQmаT!~+AwXL H=;mY<#T-ClH븟uy-ũ$uGn4 &z鷪J2OpWRL (&`r*μ )A2*Pgʰ鈧O-Ntzg>x7cZϣcߍ 2ae87C+ d5m*nRBБRڷt2"|\Ρp&%.q] z\X@{};%i^jyiu H27>=KISsK\QtF x؎ #HH ^AKj*-hj)]n"[Oo dL£/멀tk%9-+hMZLPn:8?z>xKn-7Ԍ#)&tnR|ߨQ> h/R$pJHKQy?,<9':n.ԗ ]@f'cny[X*ņ!LSV.1x4ȈՃĶ -#cc}8M;xݒ&E5G/h7u/f@n2s3:f@@XE(,O3 dsAR,\}+Ӓ | C\(HosL{3<%(jli=O.ဆj.]14vLo6(%8G_0ؿ8jl3QsF`M]2++eX`^ 8y&*8ZO=5qϤK8[a I*3@gƑI]I%W}+:ZQU燎a0ǵ|_Sv'n !4+XltkՙiL&ZΐJ:LUXus#-iwmYEP. OWD 8e8kZ}:Jū [8M&"ꁨ. چ]5& 8ONn=`,U=)åƾޝ uϩNt*q7jwie*dnʼU(o uܷ4s(7LD4Ыag,RB(9tIyLK3-q{U_!gf#MzN8yuoAO<)2_@thۭT)peNsӪW][$66 +)K )dr.mqj`[h@znhRx D)2h}p|_ o>yh4ؒ\TX n$(_Y݆dCBäU]?JJ lqnO Io#X(Qz`E>/>|Jox ČX}d pk7JXKCu]י3rGE+Ǘ4dCl5Evl l4HWRIL2γ!?/9;i}CKX?;@j z{(_p*]D\Ggkt9wADjLm wX6گ{ZGh (زpq]v JlFŏa5PBNr0Ÿ<>Y鱿 F*$ni+zALBk VǟD!lIAC׏{ZżxRIK ^gC{@ʼkd*(]=G R<ֱƲw%: ED*U-V*wl~Lhא(%:E}rϽG*ʝ+ Uxj(12w@+]^%P{w]gZ뙒e"/u bx2@--\!mFvD(=_0RIBzo ];'5mFKiLt˜LXSM(F>7^ΊAzՎ k a7T $LL5O,S'J5 re١,Ӱ$fC(D1MUV@!`_Xh; Q'<}WI翆>;P6ׅ]| ! 3Qb:Ì̷6#Drf5b93&F@tBw(w čSaJF5Di hz4Mk"!aOabt3w_qY~x #m7L1Ŗ$g]:vkJKM[Ŧo643}IY֕ nK6)&P8c:-B<#(݂uu |{ioxzŀ#G{Ga>T"iRq gO$ Zim;-U2=κJ޻+",'!Ah[:@C!-suChc1 15s-æn#Fw.!G<I콞X\aXeY,0QO/uM+hfoe-lfQݽ{3F9*CKS- :@^o>E6Yܟ#ǭ$gzç U\QfŠjtlǐg.]9],i}.vJ}M󵀳S͵8b%$u)C/~fTrG>WP^_O? ^F!e P39᪃xlpN6RTМ-!:5֨e^T|lG ^B ^.Y@jW>nlS uGDl]β>Y9dUcGor!a5L!PiaA\H+Ĕ;3oᵄPikcN/8%7?P $+JwÄGo*,/{C6zl& YIWc硖D*e6rVσ6mpQ?~*O@A:9ҚhsHgWYe\);Y6D.I @ 5_xtqdÍ뮚H>xfą#>Y=[>!գ&!eRvuɉjxmaY|=8#%[ ^FIEM}BZ-QE[@i쭿ș8# $a.qx "h¤#kmVk@";*Ao=D,uRm!j-JG3AOޅ܀|w۬|bGy7 $=An5wr0vnm)*XV kxOlOR~N\ݫl$۴ُ>Es5VQG<|\v 8 g7(Klg0P>E׃Dh Xg`s4S̷a|7:Y ӒyDW79a5Pe:xb;k!Sj '+XS+*)In3vM~l1-9%QBBڧgba%Ͷ%5Z!:FN4s0j\֕)WmY/+cTOw9P]ԈgB&P 8_gePgs_%OH|;]IT7] ٧3rW\fz:x󎹀vkdF,3/WM!YfꦏhMءO^GKm#TD3Zy p6&0art%E NK|i2A4]Zt$>ߴKїxBDF6zU襆bo gu<&_Y/vPIKYd"W_@Ag:z媺q*a" {T~GkWqɹC0$q8@y/V~ĐʓVsy5^Dq=ܨ4"eLbD\"T:M]%SY/UTPi?[`` R?D c=9W=޳cHX؉"5ϓaGMgkS]Dqj"MVt ; f.a3Xid,CF,#N :4}FkϿO9]q|$S*:J6Hw\k?K_oSꥨf MjIh7=˥NkU"@' n 5g@/)'g#hOJ*0_†pSK_Qԭ[Pr&Ă _Coe&T%W _ >b̽6 hHMSsϼ5kl; /H6ۅq ;fjtikhכjo~)("B;,P%w6t_4Յ H?D>7 lp|zy &]nDp?# !v1v,2Sll'`k?8r^Jn!.h#KA;#k;P-DyõXqzOcY͛Ho L(cߎ̄yDsc׌鷯3!lhQm/EroӻpCQ&y_ܶwئ*T~j@ yr"-5vK%w.oTd0'm||"mMT }pc:ugusJEg*Q~sv$aANFLt()'O jGji݇3.08Ke٠ F 2rRԻ,r`'B,~H[s|~)w3]jh1O L;ȹ5췲< :ջwcS3694Wr*%[~Ë薝m΍FW۾CFڊֺݢyN t'K|^(MQ& μlWIbbh̹q#zԭX}]0~8XU[j*vëq`&YKٛW_V(VCˋ"g[7f&fMruY S OGEmM uE6!/J)E%bYHv֭sInO'>*}u :GC&zymM.IHȩ}}HcIEj73?I!}'-GO70V0#o@;7)6uK}# 4 Q)db?jtȮ K((j/—UR,p7:<*Nx߭kzoOlw6e鮊hCHr$xpnOҒh)`-D8 lʸ\'BU+~&vNv9rLdph@A3txk4!;K+!Uu#u#_RUNISc󜈑֏+W8 qdv"ÎnR*D?xXkz 8 sGqZTވ{ REOh TIpٔΜjjDꜻn%;p4J)Tw ;}R՛&*y 5G0>aB)hްnXI_ j^yaXSF̜"mgt^e 2# $PYpkY`[E=/c5nw-0VdZsBIb{7 J[8N01r-K6"]5Wx-QOG$l0! w_߉γ x &dS5=g:C̘Qr<蹍M!W9P0bpNih!/ϻlYT62tw{Ty6LRŵrNJ(㦿89S]]|!C'` < 'Q嗯4w8eJ/ÑhY[2#R:Z!(uRsU+G='x`̮Rp;wVCYui>tRvt­:rC1@)PuHCЬ~:"AzLb]FN3l\G,Qf6\;0|uQ v lb6>Л0=o4պ^A&Ll2,ݳBy)A6wvm Ʀ[Ua#p v:;K-"XSM$}at\8 R:Z/$2.b̜&M:Bf+{#i*hbt/ 6 avMm 3~]8&O2h>FR7@r]Tck"u/wFN*SZst3u_}mkC-ÃQ Τ[fRڸR"Xg}N &ob PA[_tdc2t^K8;O~j~%k=E`ģLY[fI/qU&7kYU_m{?tRj su?X^T|QBw~`b)֣."Hh&\= s!a%{ PF$ԬD$,jp{ǎ] Қ2V~lAtj~&Iqi!MA<,QNF*pJ-YCߦ4SPkw?BfY817\XGLޝ{`80WJg#iQ4HtGJj]"hO 0w"Dsq\&s9*r?F JUzL1L+E33)#z_{ e P7{"&%6V^ED+|E|;:*L'_[;f:OI`Ix //At3UyB{ A/|ku. pcHoyMҺ[ d6[QaLsƁ;_'xɺoÐA ?y-nvm_i"IOp!LUrEO3t ! tˏ7nh}y!W-ҭ|b4CT5y7W7|tTQ0Y>C^tɽ(Y$cr}lHk$?D#6,(žHp[z_g>}FX3mS@GhIw*w/hyDru`z1e[HQTxț=*<ϙKumBzg(djsBo-nqw&Diн)f6s]i4/ho-8|$KD)ՆӼ 5 st8d)&E6-RNٳ-xeKڔ=t-;ݛ Hr_qUH|vF'\2Ao=;Gh{; =Ssm rRۇK"/RTV]>V^gOhe~?{v@u j"jD׫x[ŬFH PSuuu!p2+0d~:nUIGywbyd*~v=1GQǓƁ}&l4_NGdY"xȈ? g7C0YQ | o9aUAH_2[ }lhj#v54,ؽE!?GoxN1T.u/Z63<$F>Qt4۔p>uH ZBW XPKQSQqچ8NBhF)_*j\Vp?rGKU fZDd2MDM@mV5

jLe}7ֽ-}voM+@G'&-G&~QMۥ%&|j=4;́ʫd=enR鵄CG%7"ݺ]ȱ59 Ԕj͌M8hiE4:y|U&EIO;rEʿ T*7둄Q};%%͞nUŮ˿}Iʒ[( `JmY`hn qX `#p17*mDiDaꮊ>~8XE܎Roht?Cc~SE"*/0:A&(˹6ϟei ( `1ZmjTExk{ X.W;kb()S&J{vHDF~3TVOJ]H&o o0ZĎ/K%WMH1NkhXlhkxBWzR%[EHuS>eJI% wߗc-"e3Q& Df1S~ݯ, /= p6!eei)+kѱ6IJK:ȩòHpv(ZuXg&V1]vbZA; 9B@/4E[5t R-OZ bʹS N fFuS)?ӌ?#=(=A\}n.Rlq,w2Y4'^'>Cʹgi/3%RfG k7kbX %`47^ók6omDi[jG<yTs-<;Wy:Ha|sjDN#W+A:;? D%rtW3=b<ǣ%-!jP; T)ڸ''~bT@ie%d,Pd pgUH(T5 Q[S'ñCFGxѬideၚz :$U2QÃO -W,ӑb D4oʺ^4}#?T3QZMIEwyS AXZՂH>#HN2lԭmVKѾ:' ՋXhjt6Qe#0}L]/EݗMOp)&n|U .ljN-l麲KqdzQ?uL̿`tc]Ms b$̫7nTo4@YOa|*r(ئ*}69lW{ʠxGi]}R CDpiOdW` )4,i2zlh·t9oikp *55V'xڊ=*(k[*O#B"ki%G?T"WK'NqAKtf嵗s\J7!NZX$ ߻g,|:b("ZP@TP(IB[1_;^,u78sMo]B)Z,")jRuζߺ&Z)NDA8נyt8KghS=YHǖ@p)G.kV!JI]5ҺdDǯܷ$ SFFu9.ubg4ϡ"6Q;hەẻopqz*0pP5|Va"jPeP `\0̅wIrOsvQ"1`~wtQg.CSHlZۀ)ed~θW<݃Fu 7J)@ nwV L*UYJ(UK< P%n(6L'A%ir|LFqL(i Z*Km!.[dŋÚf>퀄]vtort~^V_~R)F&1mh.}dhKxmQקZd?øBOGAT = VdԒgx]9s}ډ]%ɯLW-xQq/ .IR ~;U25wb'E!Izx"Is. [ϚQF<רׂZ ?zJGũ;EltB~7' {u/8hdžTW%UCIeNО)4ׯ5yJ) *9K3ײb2^'$ƀJ6FިQU&58:hP>ӐKo%oAL.ڍKͬ3yMJc/eSJ+]^ HL0_s i^Կh 軹:LGE `nͦbԮJd>hˉTzZ{K:RQjkrjބRNh0terh?sV ,+cey i"Үw-])oOzkocL8jip}63Z$6 `,.u. m[@dTX B!Z;zƎh2QC'uws!:x/yZU.>hA C ɅN\R^:0wc!GI‰27=St|]"q )#V'SդJI@l/$o''R5nh5?YTtO?ֺv bk#U.sC,8TGTuXMsTM!sm|*$ ͟|%qjZ۠==.qOOg-KXǬ6u@ @'YrY0`ϏMABuI_KWy\fB%Κ! 4 %m=hv8?rid xxԊg.VW&&MX|,{nq m@yb>@SCz/:Y7T2+ά/Z@hmBj]hћ/@cv'MaO09kٝj_2> AW{T? J8k<>YfCA)brw}#NXZ\ wo!5.ӆNhϲ58iq7 ʃY';4hlΏ O]^ZU {Y[rg.DX'H%2; L37=pCȒ>wAHYm,(V7Mua&qC< zT9&Ӽ?}U iDrb#BϲL2lKaAcCƘZJB֡WN#(:cxlZSsQVmQMي:l=i(h$tYOõ923%?(ܪ̃ЈcL?Dt`(ߵct@ {>Z|2C+-Jy!n\uiY.tE!/b}mF=4[isiBls 2XRWЪ@GIҙQJi \46WaݤKߣ[/> (35;az f[y ̵QC"Φ+'>twފ57y#  uDhx(ͫͥk0 ltv;{@&Mp }Y^dWgJ$/{].zm !K Y7+o߁e"ҙ%8X.Yv }1l JYVsQ/_ץj)2LH?V<%""r9L= :\MsyŌ=،t6ʡF&xwǎ }Fҭʹ]2qpˆG'լN[D*߳!)AH'7aM 0n&c.#،7LJiߠo {q]R38TvC^텎Wd71 ir#Qq2KK)JDžmW"~T'ťBb!~bsz{J1'8儔^U1kZPQV@e6#ri›( "ULs)Nj؅1@/NĢf jPZ|z!WRȬ46u+x8Me, %-+0)m 8ذ_pV]*s5 ΣŇ#h"sςiY*-:jNӵ+ys"CL1e` 1u{gA0!9S 5Qu疚2\nDށ l[4țPvxIP6 ;Ig!صNR=,{Vhp-8UGI'k_NuؿYq&$o s ST-I'F I ۆOz4: 7c/wrqx܄U GXg~Fy|R8Yt# ~%!pq`0h&`J# ,i+$%Nȧ UTnTeGHŷvAr*C.9ZyAӖ ]!y`7 U7*y4}ɧW{P0ۡ" k%.^bh,ռun~9_Ǥ@YQTfT7Jҹ\sI0m32G̳C/)A]@4N'ݛR+~\dobGzn-SZVJsdm| RۋY*ȎP# ƿN~'H]q“֖PP]Bv[afql W"Ŵ59Zǥ Rt2IPo6,U0:X9޺|ޓsTk҉ޚpV:Q=[ɴcȐ_fj+GA=2Eio;MF[aP'YRUpyo*eTl0Ow[v46D4{iꔔj0b[o:q!8R}`B(W6:qZED9Z)L SKV fQ#Fk:!`J>7[:L#Ǽ\ڶ4d1(,yQ?RTeeQ:<԰65q卣iGQNw Uv:/rS%) {ou^D~ӴgGtV ǵ]ڒ;"h3'26øG~^YX md1@Yl$]pVJ!.gxV%,&az } ]aC"J2$<ގXw<NHGΐߎ,:[GΫCPdg`H<5xɕ U#9!ө _ʠR_N+;/c$," -VwnȠzCUћ'߀jv '::MQd۷W~~.vE*Sd0W T WrExY#А=۵״<3g]k\\%3j!p3,v&bƶõP 5BWH4W>ُ֏S'I|1d0t :9oH"R<a`lny,(;`Ԕ+%=|U]i jA<`!>MӾWۋbewy&f]{`oK.z5w:N-SKKL3R,q3qM(aTBS){F--R:Fzkq@r\N;KA W}ybA3e1{Rdr1Տ#\f88)3LNZ#I)X2W]WzƮLqeS rjRt@F>:ghic"[!֙.S?;_8 Lv0K< wUSe4;Ps6 mXrYjȍ6rK䇥  geTrhD+Jz|JC颼 / e {#Sejj} @r: :cS/ @Q.@):)';}Hz5$rA͇Jqnjk\.##Bu /6,MT ՠtAD ywcsrzV늧̹'5cc ierDU^=LȕS%S*>i:*b&zX( JϾ@-\|F_GDkCgBM<"[4""t=ʩcWB#dplDl?oΠ"C@ڋ3Jngw70hҵqΣr'4ω6,OP"0tSa[x+2AS\R n>MDM inD,_Dk:DSYao&%HcvV ;B*fm(}B*'G6'cwwwR&>t^[q!#L\BS5*%B: QOY.VyeduF*J4Sh:Im㯩o)mʕpU_cp$@''3Vf:R7)Т.ScZcU37rۭz䠼)> LuAsu~L5EFPSXF{3 X#9 I<` zT^/<݃Sx5kuqAi]Ǧ5AJ9l/Yc=1( SQzK ~O+c+r9 >Ǡ/6>*x҂|LyWr5Raȱ.Xh,$A?♩]U|w"::Na >}&= x4 %er/mMt6//%r}E'8#2wY-ji>}+?*P744N~zC`>?3(AB} m6N8?7Cn=w gѺ,ˤ0"`Z+i7{G)~\ܿm _f˳2h t0~gZ܏~T3Pu) Ui'5V<:x";dxΎiBM{^|eO6ZӁAi?cE{ן")4tZڭ dKATYREkbX;שw^̏~yh^?bR֠P4+=适@vPr;桅-T}K!= 9ZDK%ki=T!%~ ␳ǒ䲉{h':F;&`FHK1K>hiGQ=Y:Զ^g[4H5=<ǖ-0H_|"~l}5\uLw>rp׷OJepwS]IJdnvBqmIL ꋩ4aSvj(+GӲ]ԕfeX05U,^֚G$=hSR,Aw(Cs񋋵CsgIqv&LIR;piLj؆[Ƕ˴(aƟP>ȣq. r 'YH+Q=+^)`G <88S?Xu D@`D3#^stŇs ~C+Ȼ Oz@uAN Baq2@K f'T:r+w~u`#QC=ݻ聾`6L[7?t56D/è9`4ziN,|FtC`9VQ@%MN`#ML1M"g7,چh;iGvɟV kl!pǐZ~\BZ8 e9L{KMNkIxxr˧ApGݻ\GactρA:_WܚߛRF*.8-۪\&e@IfY~4PoS>Ч+R1RBۘq%r݈(e gՍt*N:y]n;Ǣ/jNݘ]C}', Qp~K;٠#{(0߅y) l~ٶ aM2޾)3tge _DOBjlPOV< $`~&%v -1yصWIh6dޢ(dFjz` WeUO1hXZ.rpf'eݑ2G ['9v}IܘG- 0?¨p!?G_eIb#!@zsv4YO;l$x[_28^X/q ΃wL6oH8ԟ[UgȖ*TPW5~COɮ&"J:Fx9:Z$Q Rv@ {fHh ^8G-婈-u\Y"')WEoOOw٤3^J7,uTgbT.ΟrUjM^#XyDuH/Fs4TR~z95l9CF[5ZT:~v%6G>-= n*2ZoCqɨMȂ$VRgY5p]j7NΖ[7{O@ˆ1HO;((s; ڽ&AU[r0 zL݇ٙH]1ס, Pmkp*d5oXnv"΢|/g8iyJ Wהj:F3pI-ݑSCF`< +P*'4܊ b&[:?OiH}|!vJ_fR|.)nUwZK >!Dm(Kj DCDS*c EDߜ~Ŵ@Θ0wCW`d IZՍ#f@y+ \(,f8hpcCr1IV+xvaY]8x7;**c]Fq| q=t$BvkRYiYOx˥t$fLUs3UUdVJ0Ő5Ǭ09ͨocgw_/,\W*MJkWDtG$F,1J{ -t< «(uoZ^\/I`1|IDl=D( #D/NaŹQ~82kI01y>4T/s騛Ǭ(m91-J vpKwad4t-ޱYNV؞BCs) kƲ^;1 heh"dᾗ4JT{{cP ޔ%`.PqQy{xb8b0 vS} p~Ůyli)6㌥,,+Avb+= )3i*,Se6W:@5wr f8A1D$C@~!qjC59Hz~@$* 2YTO[U[;d\0&o+ELKp\}ƆNׁgQR<s(VhW_N,5;cQEYrE,c(n^Pr?, f*q [ ҄)~̓H0'W |08>gh\H6 O򒘩=[ړkF/o} KAJOc7ٟiGmqJʱg3TLA?3 ܗ-!\=4tH{_(Ȼ5R˫}caSdބŻ`I_1ʩ e:C{IPgw2njV1;QOθM߉ c)&Z;gr0d+J58Qi_OGP@|D'sP(G|j!:A9TҐ-e2lOA03Q&'ݕ[ËW&}%3 )|ô@9@ra5Sfc9t<,~l;1н@/OY!5|CqMR[275K)qi}Д,Mq{zD|lRju`2l=CsU=Mko r2nỳ 7R$Ydb*AP<-|Wu#ҨY^)A*.d0/+^RZdǾ3 #N&TiB\?2w&w.ɋ'z %[zVI`ɜHn7 I KI}7N'}ƶH[AyYHqW"RG<1̠mAudd-!#zVL V]}& 2nFiNhGO6D.ԦF\|`Krٔh jb3fG\76}r&̣+?"S{9)\ "rZ IrAP TfL.CTDl Q@(H qy"kFSdV&%qt,F]3AZW _3t▶2_YqY 8c'C~IZA`rIŲG℻2Ϯ;dZ SS?V'VxCiqCe- Dbߖ=07xU`Δ#b&egjɈnu1n^ :l*ġEI4)^-(@wAj-̷pl؃f?'Cس:%1"->,6bMfp0*ʧe YsX2DaېDS+%{VzE@ۨE _iN7sUOdZ)nZ6 MDMZa9_$:*w|Mg3̖bk_]YWs!ZM2ss^c'0tCDtp+cFv)' L> nG~_=O, .GZCNs}"2A~OP84B\aEt#NSGFufkc(ԃ_4̒"6r1 ά mi`W_?`_zeG彽6kE+HLЎJq+ I>GP3_G 9 ]xRO]WJσ^33]~w+GSqX Qxu1~Rݣ#)׳k']rVA߷ў+Z&: =v .BTp4@}6Ex?ݩAqcZCƍRۮ&(DI~֮S"'.КJ}+W9!UP8TQ vՙedsiU&?&7,*ͱcx/po[:Қya+ ~trSbn.v+dB>4LF|Tdś$jUwוn7e+,]gB|s 7TiZ9èP8jFkX}u^O ;H턠CVbtulf(y>Y7ZʖSf&zhA&AG}92ݎ}kku*i?.ɃmHXxFD=H`!$=%)!P,I^t8 -ۨ'd%t9 'BbwSE2+x YxK (1v;Kf;ǪƄ<5b)93Lohi ̀}`x1>Iېw\,'&z6L:.wd\fB̜e^+& I'Q$XpFHzYsyqD>Ղ,@-]1~ǎȓ 5ɀ0պHD- ܌%ngz)BKs2fR @H}24ru:L΄E=;xbZ =3POD;@[pu-JG"?ў9Ns`7+jA#ǫ'2EZ2WehǒC1˞p*:\|A(8 ^q1S} iJlQa^ZJ; G8Zh e{V.SQL7)iΰR Θ痀&K2cء"4mIdbk$hR_? lِp-B]Mvʟy"6@~>^NSx-< b0!V#M)T{Pf@J[*Խ Ď'\¬^iCy,JL3aZB W7`<乨[)}1^ 2IFT[Mቓ ^,S: yS(D@K^Df&|Y0w? ~0E\]3wfށu,F+#kbnj6Rq4o4 $WA۟-I*'bF aOG?{M _*\/YM«Cc=uYPm*:v o󹦳(>e3fWt:hn 楳ʉ7mH$8idr1=wy+d:Wަ)ܟozΒ_Ie?}mcR!;{4"A,7)h5Bwlh$"#`TSO Dž ԣm3pGYp`bJk {舣a__HMR؍5yfV+#z:EX))<~F ^@6~7h7V{jުMh&Yfh{ȗX˗~SIsGSn+3[nb$a8r?>1-'Auy1cF|lgPɤUZ^Us7ڙ(rBW_q*c2gdCۙ4#IC9az}{%Celz Ɓ]6QI Fpk余Qo>B8*[ԉ-<6|1oWzf$ &g6 .!4&N> Ϋ䁢+ [䠐uܙyuu]] H(8Y$K]HYw,x 6Λe.cO!F~ %&Ok/~j>Tс)TN9 p:"@ytw#Ix K/?1cٖ1<<$*;mSOdDΚzk_ Up7 &~<@T]:{ 'Jp3QJ)kp "7gܟԣaְ "&ABD5vs/5̈k4 zBρ H={'2'1zs%d,0U37ί1tu,GTYn ۦEڊTNyScr/߿"JbBzFSgW3Ӆc 2tˎP3(]n8+W$*h۞VL|e7-"!a49'ŝA%.&}]b٧g:~wPG-tjYFLD01̷T ! +\>Éem4=PDP+'F/GH=,AەN%lT \WD-[!)ȕWU\8rFWTUe_c1͎ڤv(󅅡9=0N F^Zk?ge}kbщy"4D h5W?U:;Ē[ɪCٰaY|zhUIDgSV[ؓnC (TcG'jW4F)i a7; `)> 3OML;SAo4-hpRuϻP?yM k!I˿*gVJN9zV\$0"Ejr69^E&qֵ ۜ;X[NgⳞz1C3 ƍ557[55j1/U3`Je9hdN7$opPWI{Su G;4 ڨ5Ϊm믳6rjug);jF;:b#VJqiE2He_,";*P}aLVVkʕn©;A0T@h%YQ> ,Imd9 87)_UD=$7}4*?&D֞R׫{8K%)(B 3U`'5 eTn 8`u>[ u֊ "ëݻj8:g@fiwbP쫡 oGŰOi(Omlv2 T*bfM`Z"w>?[Y'P`bA+aKr[LjBDr|bbs7;xoΖ,ZTc|KL:sXK: }JvQl &ڜQcv";6EvT]B.5J AmpP 2hѱuZL!*$ld,Pv h CAnW2%61 `٢E"^]W1.'u?*G3mťJ-vܫi %$IPispmDQuNl$6qrD|,ͥg "֜D#Cuxn-9<lvٮ17,>kA07gz&Ċzlnyi^US1ٶ\b%.{1(Z~~"++ :4™]O˰fW\0rDZ\!Ja\[f^R=pI3a_XDdk|鶘#X:)$3 7\w$F =LMviTLO) $o zEֶVl/RWyí10s88BIQA YAέݲ#Jaѷ, [ ${Od9*U$!%w"}c g D]Z`S}HuPCdVcƃvT W&aUnׅeRM_]D4Mh2wQ v)onL,Q("U클zm@^vnmbVd"0m܆[idyXEL~KĞ+#~&w0U/:%񷻮ܽR󘃞3>Yg񥫵,.|VQPb찻36'PhTEVأ^m]dHg&MUT, EcPMi Nmr?]R)}δ8kU}~I\ er9 !BŌ*<vո$Lרc*z?>E/u6ϔ~Nܨ ]CR}MdVjħkM>/ @䷢{6kT(/)Yr֙9pH:ܢGɮ\ EFCw(^$@>cՋaa-M:a~05+J.Ԩft5"v\4}%[uQt~4 P{"}[&6Gj cb& _뢽k˒$={\+÷B,=[R-e|%(#PY1*̕^w8jҳCQ`?7J7Z !>[,;=DZ4 |i%|ôh. .C<P73 efBd&Ȱ}HpH?CQ1+u6 H{RG=UW賠ON%z1әy(Q/C:f; `B .d@!Io!Lz z+,|΋#1T;>)\Þ!.MR> Bkg;RB$+6Wfd,<,[%Yd*N1ކxY*40FV|,#+Q]2F48w ذ23OWm*P0rQ+C{6YصvI)LqsFW0L~|!jǝxEjt(9hiA+5;]+ȇ"T5:ے-XD.CwdLBo~6_;pS?E CX6d%z/jxzLEUQxጯOXN{j!@O;)TR .t\"gs:h#nZx}!z%+ x>UY$<4u֘"ac0qq5uaN8Z)p JVRz:Aou+t~/=s:l"\8E$$61Y8UHzƠôiHdmMu.@dx/X;\(s pól9NJ>3mQU+ǣ8g%* r,H aܶ,zjy}>YT#w$eiBankR68r@2,䁁` 1f+J =`a;*nL5_uSgx"#;u2WX\{BTp(p~ިǚf|>2"zpL⠞<}Ng&)B d`oj \{]:VM_Һ<֨Lr-4@^*`E5B[e;/iB<![S꼯 l@~A+N+* .c·H^&?o2%vZ'zx ^Ц2fOd UbdVզŔ f䤽 QO9) S}$X)`׸š6xGW[VfzlwjXTXߊdFT 4JC`Cb-oPw6^KĜlk//S8v.?VQtzϋșp ^Yfgv[/ƒ%U¦DRɽ::VR%^" 7^^rZ~k2͕JL6a'kУu:GOm`,uT-q@ZǕ|a! 03:92q*&05'׻o"fqK뀛A&>HG)gkzf'ipQ a]OƳw Z̅yexõYTfI2].\8Cp[6oL,:o]6pj 9i\.p7 ljIuan42bthLY(1z٣srBrIoYzNk R/H UPcl^~x)#`hif>i5Ј_{7C3'}@e\G6$\8X,ڋJl!>8)1w?.?k{7?x WHv/'FR*I;nym\F;U1|J%ιXVR8"cP[s>H9pr6 e*O#xnouc1!W׊]!Zp&Ecȸ?`y)غn}oݦ4)Inƴ$=}CLTZN,#_OZphL؇.WRA'Z ql9 (iY.P1}ldkϖI6 ڗNiЋڗ%^\7tA{b}8ﴇ=ه oFyVeo/twՇsGOs03MخB|rzfMVf;r.f/'hgt2(e jYzEP#^S*h#W4xlw&NxR|ǮS QˑqbrB(ħ{ ʲ_PgofqNr"HVQf0ZeJ&P C5ƙ[28>cgͣ4Ej:Z*5Q jq@gmA"3Fi6"U:2FA*[|1Y_24҈M:OT9ۇT{A c[o{_tib nPC@ P4 irƖypKZՙ@>k dբH::Tx2aפggU5|t."oYA5q10S%  MC%:,.ZI9 ~QޟwMA6L.ѧe)#f{$W+1iN?`mH63pwDXESeƒ-]f:+ ,;XЬC 岩G"9;i?nB2%\ySޓlQCgCgOD&;)adg(#ZAex(__lijBcZ8r̼)<0єv3G\){pW,IPk^s^Sߥ զԀBQѳ4'P_!9iv2ES$㝷b-(*|fXRRM,Z$VD@ {Ÿ:cAX'Rif^0msfYB=꣐eCAN:焻kcHiصkݞIERU{:oy` ȅ&=޼tlC8MYJfX2Xo)Ň-q%h$N'C-vF׿\(&AA݌Ob^ cg`YR4Hx4~rHiy_bJZ7F#5SR  y ? бd(rkF=;G]7f4Ϯ}ewbPFIM>qŔ⋳CYdo 4{X?PW˚Ƿ]J3uz;ۄ%3}4-r˰g欖Ecڗ$Έx \U\v{ lk֌2*"fF;.a>KնOZKȗя 7H(W:qkMEն> c$s"@Ok9 f sxB>z⨈E#yCN[4U Oֹ2Kw̨|w4Nb"N6k}wy&LY)9 LlCoH9YW8a$ʩ;S".L%:p S(PaSѓ@ o9yZ!s$)e| G{iQs L+h e|1l7B2lD艖'` T$l^g mUmj~fbYlFlJ<7O!o@p6$/kh}p^s@ rȦxyQ\t)R aA;&?E)ijʨ*v@8WRɘ%8Kنn} ]-- y)R,ME[w%H1{QtN3@wbZE- . -y' J{i܎y^bKOY`1if  \  q#'LlpE r7PzC t쳠M0P?2[b׽ϧM HL@繋&&y~gRg褽,4/˺&Mж=s`/k븲]%V*YcP3ýcY{f!ѡ o2l`ƉLrj:(;N q9y ) z*֢mve!d'ZK)0 @L=bmH黮133r:mA34[l1иI1Ƌp[Cs^:*o*X}U{Y4}8L\Iy|F~GQ  530m'*5CxstQsrs)ΡL>}XD?Vi ^R5&V\/IpA B!n-Ռ~161IK`{esS-w!RIsD5mwj F~h"H ؖ[fd?Y{B3$"X=-vT/Ly _PCaP !Ұ$L*yϡmhQ0DD &Fc ?t'/'IYؖy@c7 !lJ6qQ?w:kݓQ0/#{b`YbUym9YR tOWS;-m;-{RnVНNtu>^TfA) ͵X*LpԃdsDaۦhKqȶX çKs tYҌ-: O\1)z3I\ FTb7%CGb.G4(†zAU2f0ަXa!9J2Qۋtꃲu{8$tkH-""RGL DN֏d34WdTH5{;=j[H;]>*lVXΪݜdRF$4IREk^{b$A \60*`g@ml]ƨ~? qMgf}0<8:":-jۢQʆÆYn&%D p8E1 fc)̠0'N->)L6YADe[߽^.!3GY/Kv1]J-lmv~~=E2apPɾ_Ƨ݌\]`4&dB-xIEg WO!BxFn/9@Ù9|iۏ˱Wt#I+w퍊٪-b9i*|-4\sLJakЈ`S93j7 <"TUPw2ogp3slZT2RP@elp7In=Kzv)W *j8ɶHH;'tےXO,ԟyN**(`Vbb͑}<WꡜP|_]"  {O~=HuqwrhJƅ\WnbߙzJ6g@" Lfon_ʜ͓9 xVi;b.We![85`dϪq8X|@% UrNH zmDS" 'p$ /:FYc+xү=DΖhq3pEB+Ǐ9!JƂHsO5j{&ɘ R]0_ɱ|):#;G)s-hU=Av`#H7;<4#K\^*Gyll^anzb &53!q@ӁJگhrD[Tr~x.(?P/)3NRlM37e\qu )9'$c3sਪT *UIb@HS}ƺ:}_Fu2clh)8J]OeINl0yʿ'3ArRJ+cV~i+"VL LIWdSsUBqo;zV`lp/M xqBe7u.:m.kޒ `#R)q qh$3僒8%~g3t]^#";$4VD_$p Hځl)P21DK /FsG9q؀UۤYHgŚ85}(!+ {w8~/'olx}? ^}_ ySc|dB-,"; ;D˝)t>\n8u3]m2T(*^"W0uw?|JNk?{vSxỦh5(;/B0u(>\Z,~V_vlk9Ȕ]P"  .^B+@(T^s>F fzU%KWSdYS9H5kv!z*ҀTxŌ$g~Z`Rݡqkr먖q,aռJInrR逛 E:Lu瀚rqX*P:AgT-ւ|רB(@ H}. Y`"l$j.wn6q d NB] Whh2&-)oy5zoK{R"3P"<)l{{#RYٰb7EQ}H[Zeu(RpœR\@ߋМwև+>9gZc,AןWӾ!j|*EoFП5EOWޥ: +A?Hr7iH.ll +H$X m}3BQ]^K.8[uigءz@8$Tzi5;@#HŢ ]>W&LGOApzf- &x܍kt5:ؒe\\sw$쏅ݜg$GH6%wr&QLQq!R ^fVL1kq~x:~A=۠dL;vzZp!wdgxr~OYwE<{-T]-YŷI)|w3`[A0Z3Рodo qTUw+{}Z(+>BkTP/*7TPr#*rosN>IͻsK1k?DpFv;g,q6߅ه<@TvR<z%okʃb7Kgui<9 ޤ2HG2l9ׂH)m5>d=jSӧQ,jAW!MBJ)Tm]ͻ*d᮷2;Q1VɒXzX4?c6ڰ,K%=aN9n#٠ OIY$ T_a 'mcZ;f}ژXW=O77=M q㟘Vs*V *D#AO@M%">ț^P (|fX7T=?nu"Mt'?&{ֹ90y$]& ܏ayC"`X_QދqwXWԜrJ-\{[?bWEEoĹL%S%.v8,Qm:;;^<2hKi'W Unyi)m]x$\98vCdB픧MD.+:qr=G0Y' Wdc|S.,S!ej>:FMȍ.ʖ{pST ̮2$RBj_3RI߃ /VjȲe[t _{ԏ=Oah5$&QÃޓR?&. I2LH;z?rc>aHh#b0mH7C3f*0kC버.s**=tW }4QrMC;ZȖvJy,a{@|ס9"7~@z_x]9: 6ڧ5 F/|Ā:~C$p)<~n|D5wn&.i-e$5x yb rxLR˜/O".9J : "B4W~ovrƈ?2uΖ˸ VHV)!էr=gsCV *wNʺ_ʼn`Et|&X^։LT4u;"q!=rb<#; z:6 q8 ^u5 x 1 oZxu|Aze4XnzyM1$` 3b՞/PG  83{Z[LI]፥#Ⓑ R2_oKӐp҇䊘uNH@Xӫ_v&9W|.kG ݣ 1rCDu uKt8!|ܷ"H˹<. ,K*{Uк\Y]B3a;tjy:un2 ~xgmDmtU9c`m2y+)aT|Uws?v',|0YzKai񦆋 wgI25 ^1!<)F낂lkԹKI$-gDk\ѳlU.~Pr1݄&r~;/3K.r?A:N&==(V=nXۏI c#?ڴ8%x$]O7$ѽMeD/t)Kj& [JV]0fz)l gloٺƀu3(8PQ<.#=ڢ`;Ⱥf6?p6|ne) ;tq73X`5zUQ)\TXnl[ߙ7R::'abS'.sldf:z5 ~{w OKN,-Kw:C^F;ڙy_'^ӧ4۠ۼyk"⇄Fkg '=OhUΥ_U?V@HqlDk)=D/0^fHhRRhwOZc팭3m0{I >W X#jгyl(ɳ.\^= 4DX&w;pT4!z8`" ^y~"g/=mTy'>4BZjeW~~D}# NM٤建,,$7gp y[},} ]8%!֛1?%[ER@`8:Vi>.*><0>{[c@SÍ"k/;2L.W:5OUJ˶n>4 k Pnڴnp/[bJA6dS )9mï[B,G"VϺ\ʤ8ynu0!bN|!ޑYlGLl`gKWT=|}y!I0' N,)m ) 9GcCȞӮ"9tƽ(8{   ݤnvuqZL'K bRtE;_kd@obwRrg%@h2OQ23ad>)UpV:8CD ʹ> 7ޗnGo@@LYP~z]ccuGHLsO dLǏtK6*:W8(/'{BPSqN%AM?k81A{:w#F^ZX& Z ▍X\A=R5C:8~TTI1牞kscÆ{5vu47r{CxS,wy}Qbpx|f~T_w J,g^ZP9 xa0{rH{=,ppSJl Dzmj5Q]oY .7$3]eX10/= 戕V/:NuBDGleo(Fqv-c{fx8vO[c[#0<ۃS .c'X (|hWBI_A=I TQUǸ H$hxB ]*:_5de13n濬;8ȾD̠wxIQ`动2LzK5\Gi3G .Z6ɲʛq;JG8}UݫYC&ٽ3pTU!K9iq"5F+>FXvN햪ģ\X D&3f_QF}󁉳b~6Y/C@sM@%sN 8~JO1̀Y !?~0g|6vUBhex?B3RÆ?aNs$ p婮 bdt|=.xVnuGw9*6]-c4v-ޠ !ܛI9ttiEid,!WD?ܐmC͸˪"֜ӅlcDݴ,TWg?N*$R4M(?`j^.du~ף/Oٮ Ӟk<1f~t}ݫ{p! !cbYB%E3qF&B a&?.AbAIvWq<<=RGcDތ>~XUn86lr7~[\QrJ*P|Ἤ(W Fd QЇ ƣ|!׋)э!DUyʑq?kyo}g] uy-xv*+0c*]#+.uvn~|H̛ޮA)(&s`ZͲY)Cg"9gG5.bE4$z+ uAܪˣ^`t͵aG:dVKLYxAy~g(B55lv&E+ˌ|FȧVo~+Gز;{p.OJM\ cb)Ũdγ, b^ MW5j3n@[Dn"F5~T;58hDcOE4oWtT0{ 5chxNhy$~QoyĹp_^mp|kcM+:A ]KitK[n}^5dTMxn&6'QȻZw:tm4],ҩ4 V@Ss<^/e}I 㙊5b5Χ썯aPCqHSr[-He;cTXni`?z8jtD(N. !!)BnjM4j~ֵaд}7m[Eȡp~7lcUq3 MocN{p*\[zr&^PhfBe=_p!Z._;;AKg^JCSb/:!<{c@j.|.oK^!cip`_lpr@6AЊyD7.۶ނ0-c!3?Vf5E#9dE@eP *d*`ŜQ8]90ӂNlz_<Lﭤ1^N(*O+ڿz71\z9d_KL%E7jEP%s~?y'uv3Z+׮&򑥪 U]Am3ٱⴽbLF2v5SAŊiTguۃѴ!DŽ-[f|&\/SuCw*+EY Y4?aޚRE"xi6_n@Be4uu3~tb/5~FF%s1 &3ɅTR?EٯHx}jڟ4,Z}&sL Zާ;+%,̡8,GE~ۢy4Jyt.6&Q=]l"=\a3Z? i'~|*5؀j,}lίҘ/OwD'*/Ag ("W~y矌Iɉ =aV Ԥ0Rs>l7hW I8#V~GlX,*sr /@pp8\ʙ8Hͯo+ػq!(w@!4#MZ\I̎24@}(cdx2;)zp{hB mV`f4Y$Q!9GMq~9KV.w$s:d%H=4y1!r%5{g)vEy!?6|.$;ч1i~*{Ɉ`E 8" ZR~y^8mj?q87LM YZ