resource-agents-3.9.5-46.el6$>'}?6 A1=ƿ>@?d  P" Nf    l 4& 58ӷBӿGHּI٤X`YlZڌ[ڐ\ژ]݀^bd8e=f@lBtXu@v(whxPy8jCresource-agents3.9.546.el6Open Source HA Reusable Cluster Resource ScriptsA set of scripts to interface with several services to operate in a High Availability environment for both Pacemaker and rgmanager service managers.Xc1bm.rdu2.centos.orgICentOSGPLv2+ and LGPLv2+CentOS BuildSystem System Environment/Basehttp://to.be.defined.com/linuxi686ccs_update_schema > /dev/null 2>&1 ||:("!U KMG# ##"a })u/F>%,)[U - 3.9.5-46Oyvind Albrigtsen - 3.9.5-43Oyvind Albrigtsen - 3.9.5-42Oyvind Albrigtsen - 3.9.5-41Oyvind Albrigtsen - 3.9.5-40Oyvind Albrigtsen - 3.9.5-38Oyvind Albrigtsen - 3.9.5-37Oyvind Albrigtsen - 3.9.5-36Oyvind Albrigtsen - 3.9.5-35Oyvind Albrigtsen - 3.9.5-34Oyvind Albrigtsen - 3.9.5-32Jan Pokorny - 3.9.5-31Oyvind Albrigtsen - 3.9.5-30Oyvind Albrigtsen - 3.9.5-29Oyvind Albrigtsen - 3.9.5-28Oyvind Albrigtsen - 3.9.5-27Oyvind Albrigtsen - 3.9.5-26Fabio M. Di Nitto - 3.9.5-25David Vossel - 3.9.5-24David Vossel - 3.9.5-23David Vossel - 3.9.5-22David Vossel - 3.9.5-21David Vossel - 3.9.5-20David Vossel - 3.9.5-19David Vossel - 3.9.5-18David Vossel - 3.9.5-17David Vossel - 3.9.5-16David Vossel - 3.9.5-15David Vossel - 3.9.5-14David Vossel - 3.9.5-13David Vossel - 3.9.5-12David Vossel - 3.9.5-11David Vossel - 3.9.5-10David Vossel - 3.9.5-9David Vossel - 3.9.5-8David Vossel - 3.9.5-7David Vossel - 3.9.5-6David Vossel - 3.9.5-5David Vossel - 3.9.5-4David Vossel - 3.9.5-3Fabio M. Di Nitto - 3.9.5-2David Vossel - 3.9.5-1David Vossel - 3.9.2-49David Vossel - 3.9.2-48David Vossel - 3.9.2-47David Vossel - 3.9.2-46David Vossel - 3.9.2-45David Vossel - 3.9.2-44David Vossel - 3.9.2-43David Vossel - 3.9.2-42David Vossel - 3.9.2-41Fabio M. Di Nitto - 3.9.2-40.3Fabio M. Di Nitto - 3.9.2-40.2David Vossel - 3.9.2-40David Vossel - 3.9.2-39David Vossel - 3.9.2-38David Vossel - 3.9.2-37David Vossel - 3.9.2-36David Vossel - 3.9.2-35David Vossel - 3.9.2-34Ryan McCabe - 3.9.2-33Ryan McCabe - 3.9.2-32David Vossel - 3.9.2-31David Vossel - 3.9.2-30David Vossel - 3.9.2-29David Vossel - 3.9.2-28David Vossel - 3.9.2-27David Vossel - 3.9.2-26David Vossel - 3.9.2-25David Vossel - 3.9.2-24Ryan McCabe - 3.9.2-23Ryan McCabe - 3.9.2-22Chris Feist - 3.9.2-21Chris Feist - 3.9.2-20Chris Feist - 3.9.2-19Chris Feist - 3.9.2-18Chris Feist - 3.9.2-17Chris Feist - 3.9.2-16Chris Feist - 3.9.2-15Chris Feist - 3.9.2-14Fabio M. Di Nitto - 3.9.2-13Chris Feist - 3.9.2-12Chris Feist - 3.9.2-11Chris Feist - 3.9.2-10Chris Feist - 3.9.2-9Chris Feist - 3.9.2-8Chris Feist - 3.9.2-7Chris Feist - 3.9.2-4Chris Feist - 3.9.2-3Chris Feist - 3.9.2-2Fabio M. Di Nitto - 3.9.2-1Chris Feist - 3.9.1-2Fabio M. Di Nitto - 3.0.12.1-1Lon Hohberger - Version: 3.0.12-22Lon Hohberger - Version: 3.0.12-21Fabio M. Di Nitto - 3.0.12-20Lon Hohberger - 3.0.12-19Marek Grac - 3.0.12-18Marek Grac - 3.0.12-17Lon Hohberger - Version: 3.0.12-16Marek Grac - 3.0.12-15Lon Hohberger - 3.0.12-14Lon Hohberger - 3.0.12-13Marek Grac - 3.0.12-12Lon Hohberger - 3.0.12-10Lon Hohberger - 3.0.12-9Lon Hohberger - 3.0.12-8Lon Hohberger - 3.0.12-7Lon Hohberger - 3.0.12-6Fabio M. Di Nitto - 3.0.12-5Andrew Beekhof - 3.0.12-4Andrew Beekhof - 3.0.12-3Fabio M. Di Nitto - 3.0.12-2Fabio M. Di Nitto - 3.0.12-1Fabio M. Di Nitto - 3.0.9-1Fabio M. Di Nitto - 3.0.7-5Marek Grac - 3.0.7-4Marek Grac - 3.0.7-3Fabio M. Di Nitto - 3.0.7-2Fabio M. Di Nitto - 3.0.7-1Andrew Beekhof - 3.0.6-2Fabio M. Di Nitto - 3.0.6-1Andrew Beekhof - 3.0.5-2Fabio M. Di Nitto - 3.0.5-1Andrew Beekhof - 3.0.4-2Fabio M. Di Nitto - 3.0.4-1Andrew Beekhof - 3.0.3-3Fabio M. Di Nitto - 3.0.3-1Fabio M. Di Nitto - 3.0.1-1Andrew Beekhof - 3.0.0-16Ville Skyttä - 3.0.0-15Fabio M. Di Nitto - 3.0.0-14Fedora Release Engineering - 3.0.0-13Fabio M. Di Nitto - 3.0.0-12Fabio M. Di Nitto - 3.0.0-11.rc4Fabio M. Di Nitto - 3.0.0-10.rc3Fabio M. Di Nitto - 3.0.0-9.rc2Fabio M. Di Nitto - 3.0.0-8.rc1Fabio M. Di Nitto - 3.0.0-7.beta1Fabio M. Di Nitto - 3.0.0-6.alpha7Fabio M. Di Nitto - 3.0.0-5.alpha6Fabio M. Di Nitto - 3.0.0-4.alpha5Fabio M. Di Nitto - 3.0.0-3.alpha5Fabio M. Di Nitto - 3.0.0-2.alpha4Fabio M. Di Nitto - 3.0.0-1.alpha4Fabio M. Di Nitto - 3.0.0-1.alpha3- LVM: fix for "partial vg activates when partial_activation=false" Resolves: rhbz#1332909- oracle: fix unable to start because of ORA-01081 Resolves: rhbz#1318240- exportfs: fix for IPv6 addresses Resolves: rhbz#1406843- portblock: create tickle_dir if it doesnt exist Resolves: rhbz#1327662- SAPHana/SAPHanaTopology: update to version 0.152.17 - Add netstat dependency Resolves: rhbz#1381891 Resolves: rhbz#1395594- Delay: change startdelay default to avoid timeout before starting Resolves: rhbz#1386187- lvm.sh: fix status clustered to check specific volume - netfs.sh: move defaults to metadata - nfsserver: use rpcpipefs_dir variable Resolves: rhbz#1320520 Resolves: rhbz#1286291 Resolves: rhbz#1382036- SAPDatabase: fix process count for SUSER - oracle: use monprofile parameter - send_arp: fix buffer overflow on infiniband devices - mysql: use replication_port variable - oracle: inform user that monprofile monuser must start with C## for container databases Resolves: rhbz#1260710 Resolves: rhbz#1358892 Resolves: rhbz#1351717 Resolves: rhbz#1337146 Resolves: rhbz#1374655- tickle_tcp: fix "Failed to open raw socket (Invalid argument)" issue Resolves: rhbz#1327662- rgmanager: fix .clumanager/statd ownership in fs.sh and clusterfs.sh Resolves: rhbz#1311963- Add portblock resource agent for Pacemaker - Add Oracle Data Guard resource agent for rgmanager Resolves: rhbz#1302545 Resolves: rhbz#1086838- Fix up for wrongly generated RNG schema for cluster configuration wrt. "action" tag Related: rhbz#1272587- Add migrate_options parameter to vm.sh Resolves: rhbz#1285921- Set VirtualDomain migrate_options default Resolves: rhbz#1286650- Use IPv6 DAD for collision detection in IPaddr2 - Add RAID segment type support for HA LVM - Fix Tomcat SELinux failed in enforcing mode - Add migrate_options parameter to VirtualDomain - Remove not-working tmpfs "support" from fs.sh - Fix tmpfile leak in mysql resource agent Resolves: rhbz#1276698 Resolves: rhbz#1266173 Resolves: rhbz#1280319 Resolves: rhbz#1286650 Resolves: rhbz#1024505 Resolves: rhbz#1292054- SAP HANA add Multiple Components One System (MCOS) support - sap_redhat_cluster_connector add support for "-" in hostnames Resolves: rhbz#1200903 Resolves: rhbz#1269897- Match exact Oracle SID to avoid waiting for 90 seconds and killing other databases if their names include the name of the database you're trying to stop - Use DAD to check for address collision instead of ping for IPv6 in rgmanager - MySQL wait up to "startup_wait" seconds for mysqld to create PID - Handle failure state during stop in orainstance.sh - Add Oracle resource agents for Pacemaker Resolves: rhbz#1200639 Resolves: rhbz#1191247 Resolves: rhbz#1207285 Resolves: rhbz#1234777 Resolves: rhbz#1070479- SAP Hana update to address several bugs Resolves: rhbz#1245730- Update addresses bug fixes for SAP Hana agents. Resolves: rhbz#1168251- Update addresses bug fixes for SAP Hana agents. Resolves: rhbz#1168251- Update SAP Hana agents. Resolves: rhbz#1168251- Place SAP Hana agents in sap-hana subpackage Resolves: rhbz#1168251- Preserves nfs sysconfig when using nfsserver agent. Resolves: rhbz#1179412- Introduce the nginx agent. Resolves: rhbz#1150655- SAP Hana agents. Resolves: rhbz#1168251- Fixes rgmanager lvm agent's ability to exclusively activate volume groups on nodes with aliases Resolves: rhbz#1085109- Fixes unreliable detection of nic device in IPaddr2 - Fix fs-lib.sh regression in is_alive write test failure detection - Fix properly handle mysql when alternate user is specified. Resolves: rhbz#1181187 Resolves: rhbz#1183735 Resolves: rhbz#1183148- Prevent oracle agents from failing on non critical errors Resolves: rhbz#1151379- For lv_by_vg, only strip tag on stop if we are owner. - NFS custom port config options - Fixes typo preventing passing "noload" or "data=..." mount options - Fixes undefined variable warning in fs-lib - Fixes mysql not stopped if data fs unavailable - Fixes postgres agent not detected correct user group - Handle nfs path ending in '/' correctly Resolves: rhbz#1161727 Resolves: rhbz#1096376 Resolves: rhbz#1096990 Resolves: rhbz#1134960 Resolves: rhbz#1150702 Resolves: rhbz#1159018 Resolves: rhbz#1173128- ip.sh now sends unsolicited advertisement packet for ipv6 Resolves: rhbz#1159805- Properly search for oracldb processes in oracledb.sh stop operations. Resolves: rhbz#960186- Updates required, unique, and primary fields in bind-mount.sh metadata Resolves: rhbz#1094789- Fixes bind-mount.sh metadata function. Resolves: rhbz#1094789- When signalling pids accessing a mount_point to exit, make sure to only signal each pid once. Resolves: rhbz#1089004- Revert accidental modification of exportfs's unlock_on_stop option. - Add on/off as valid value for ip.sh monitor_link Resolves: rhbz#1091102 Resolves: rhbz#1039119- Update force_unmount=safe option so it does not process duplicate process ids. Resolves: rhbz#1095943- Remove db2 exclude entries from spec file. Resolves: rhbz#1059981- Add support for pacemaker db2 agent - Fix syntax error in nfsserver.sh - Updates pacemaker nfs server agents. Adds support for nfsnotify agent. Resolves: rhbz#1059981 Resolves: rhbz#1091102 Resolves: rhbz#974239- Introduce passing ocft test cases. Resolves: rhbz#1023606- Fix usage of findmnt in fs-lib.sh based rgmanager agents. - When executing force kill of processes using a mountpoint, take into account those processes accessing shared memory. - Add force_unount=safe option to avoid blocking Filesystem agent during the stop operation. - Do not fail during stop if oracle listener is already down. - Correctly detect oracledb and orainstanch.sh shutdown. - Remove unused patches left over from before patches were consolidated into the new source files. Resolves: rhbz#1038474 Resolves: rhbz#1089004 Resolves: rhbz#1095943 Resolves: rhbz#1047999 Resolves: rhbz#960186 Resolves: rhbz#993431- Build sap package only on x86_64 Resolves: rhbz#1031601- Package cleanup. This change is a no-op. The heartbeat agents were updated to the 3.9.5 upstream release in this package months ago. The release number is now being incremented to reflect this. Resolves: rhbz#993431- Add iSCSILogicalUnit to rhel supported agents. Resolves: rhbz#1075000- Configurable startup_wait timeout for rgmanager's postgres-8.sh resource-agent - Allow non rhel builds to included unsupported agents. - Add bind-mount.sh rgmanager resource-agent. - Add 'statdport' option to nfsserver resource. Resolves: rhbz#1035380 Resolves: rhbz#1069621 Resolves: rhbz#1094789 Resolves: rhbz#918315- Allow vm.sh to monitor kvm domains without requiring libvirtd - Adds 'no_kill' option to vm.sh to prevent force killing vm during stop operation after timeout expires. Resolves: rhbz#853698 Resolves: rhbz#1079039- Updates the ocf:heartbeat:tomcat agent so it can be used in rhel6 with Pacemaker. Resolves: rhbz#1022792- Fixes unintentional removal of patch in previous build- New 'httpd' option for rgmanager apache.sh agent that allows custom httpd binary path to be set. - Fixes issue with pending sm-notify processes preventing nfs-server instances from stopping. - Fixes issue reported by coverity. - Fixes syntax error in some log error messages in the LVM agent - Optimize fs-lib based agent's monitor operation - Allow monitoring of kvm based virtual machines using the VirtualDomain agent without requiring libvirtd. - Allows named to run as user other than root. Resolves: rhbz#952132 Resolves: rhbz#974239 Resolves: rhbz#999537 Resolves: rhbz#1022277 Resolves: rhbz#1023099 Resolves: rhbz#1054327 Resolves: rhbz#1067023Add sec=krb5 as a valid nfsclient mount option Resolves: rhbz1019931- High: fs-lib.sh: Fixes failure to unmount local fs when process runs with cwd inside fs mount. Resolves: rhbz#1051115- Add no_unmount functionality back into netfs.sh agent - Use crm_node instead of uname -n when referencing cluster nodes. - Adds Delay agent back into package. - Drops nginx rsyslog mysql-proxy tomcat and slapd agents. Resolves: rhbz#993329 Resolves: rhbz#1023340 Resolves: rhbz#1028421 Resolves: rhbz#1022793- Fix netfs mount detection Resolves: rhbz#1027410- Fix netnfs unmount self_fence integration in netfs.sh - Ship send_ua helper binary to allow IPaddr2 to manage IPv6 addresses Resolves: rhbz#1027410 Resolves: rhbz#1027412- Advertises self_fence option in netfs.sh agent Resolves rhbz#1014298- Fixes issue with mysql agent not being able to set transient attributes on local node correctly. Resolves: rhbz#989284- Removes usage of fuser -kvm from fs-lib.sh based agents. This resolves issue with fuser blocking netfs mounts. - tomcat-6.sh, Do not fail on stop if config validation fails. - tomcat-6.sh, Set tomcat usr correctly. Resolves: rhbz#981717 Resolves: rhbz#983273 Resolves: rhbz#1014298- Fixes lvm metadata corruption caused when activating by lv using tags. Resolves: rhbz#1009772- Disables LVM exclusive activation via clvmd as it is not supported. Resolves: rhbz#989284- Fixes invalid return statement in LVM retry clvmd activation - Adds ability to disable findmnt to avoid autofs complications for fs-util based rgmanager agents. Resolves: rhbz#974941 Resolves: rhbz#989284- Use correct default config for heartbeat apache agent Resolves: rhbz#989284- Add support for setting TNS_ADMIN Resolves: rhbz#917807- Med: oracledb.sh: Fix process name grep in exit_idle Resolves: rhbz#853220- Fixes lvm agent unncessarily removing PVs/LVs when some PVs in VG fail. Resolves: rhbz#884326- Add correct nfs server defaults. Resolves: rhbz#989284- Add run-time dependencies for heartbeat agents. Resolves: rhbz#989284- Merge upstream heartbeat agents in for Pacemaker support. Resolves: rhbz#989284- Add missing sap agents to sap subpackage Resolves: rhbz#922838- Add sap connector script - Create SAP subpackage Resolves: rhbz#922838- fast filesystem mounts - properly handle NFS v4 mounts - fix uppercase ipv6 addresses - named transfer source options - fix restart postgres - fix honor self fence option - fix mount log level - fix wrong selinux context for nfs directory Resolves: rhbz#919231 Resolves: rhbz#851188 Resolves: rhbz#895075 Resolves: rhbz#711586 Resolves: rhbz#871659 Resolves: rhbz#908457 Resolves: rhbz#948730 Resolves: rhbz#959520- Fix: lvm: detection of clusternode with lvm using tags. Resolves: rhbz#976443- Med: oracledb.sh: Set RESTART_RETRIES back to 0 Resolves: rhbz#670022- Clean up Oracle resource agents and add support for Oracle 11g Resolves: rhbz#670022- Fixed missing '$' in lvm_by_vg.sh script - Retry VG shutdown to cope with udev collisions - Resolves: rhbz#729812- Update the rgmanager SAPInstance agent so resource limits configured in /usr/sap/services are properly applied. - Resolves: rhbz#869695- Better error messages for the script resource have been added to aid debugging - Resolves: rhbz#773478- SAPInstance and sapdb.sh were re-synced to the latest upstream versions - Resolves: rhbz#834293- HA LVM is now able to properly shutdown when device failures cause LVs to go missing which allows the service to migrate to another machine - Resolves: rhbz#860981- Add support for 'volume group per service HA-LVM support for RAID logical volumes' - Resolves: rhbz#824153- Fixes issue with rgmanager not recognizing a mounted cifs share due to trailing slashes - Resolves: rhbz#848642- Fixed issue causing fs.sh to fail when a device is still mounted - Fixed random servie failures when starting multiple HA LVM services - Tomcat resource now uses the proper defaults - The pacemaker SAPInstance and SAPDatabase resources were updated to their latest version - Updated lvm resource agent to not produce errors when used with pacemaker - oracledb.sh script now properly checks the status of the Oracle database - HA-LVM now supports RAID logical volumes - ip.sh now properly assignes the ip address to the correct interface on hosts with multiple interfaces on the same network - Stopping a filesystem when a device doesn't exist no longer results in failure - Log output from the 'status' action from netfs is now properly logged - In HA LVM clusters using tags, changing the lvm.conf file is now possible - Using rg_test with HA LVM resources no longer results in a "too many arguments" error - Resolves: rhbz#728365 rhbz#714156 rhbz#853249 rhbz#843049 rhbz#817550 rhbz#729812 rhbz#839181 rhbz#824153 rhbz#822244 rhbz#860328 rhbz#847335 rhbz#834293- Add nfsrestart option to fs and clustefs agents as last resource to umount the filesystem - Resolves: rhbz#822053- Fix for LVM HA agent for service relocation after leg failure (we now properly remove tag). - Resolves: rhbz#772773- In LVM HA agent, remove missing PVs before attempting to remove the tag - Rgmanager now properly detects when clvmd is not running when using HA LVM - vm.sh now supports a 'tunnelled' option - Resource agent script now have common directory set properly - Fixed apache resource agent configuration with IPv6 - fs-lib.sh now will now properly work with all return codes of mount - netfs now allows you to have the same NFS export mounted in different locations - The timeout in rhev-check has been increased to 90 seconds - Resolves: rhbz#772773 rhbz#729481 rhbz#712174 rhbz#784357 rhbz#742859 rhbz#728086 rhbz#799998 rhbz#727546- Fix to prevent /dev/shm being filled up by ocf_log debug messages - NFS client resource are now recovered properly when they are missing in /var/lib/nfs/etab - Resolves: rhbz#797922 rhbz#749713- More SAPDatabase updates to fix SAP workloads - Allow rgmanager SAP resource agent to manage SAP Webdispatcher & TREX - Resolves: rhbz#726500 rhbz#746996- Update SAPDatabase to more closely match upstream - Resolves: rhbz#784209- Require server_name in ASEHAagent to be unique - Resolves: rhbz#711852- Create a link for the modified dtd for rgmanager - Fix ocf-tester so rgmanager agents requiring bash don't cause syntax errors - Resolves: rhbz#727643- Main rgmanager resource agents now use proper return codes for use with pacemaker. - NFS mounts now unmount faster when the network is lost. - Resolves: rhbz#678497 rhbz#727643- Postgres-8 resource agent now properly detects if postgresql was started - fs.sh resource agent now returns the proper response code when a device does not yet exist. - Resolves: rhbz#709400 rhbz#694816- Rebase package on top of new upstream * ship xsl and rng files required to build relaxng schema * drop local copy of sfex_init.8 * drop bz711852-Fix-ASEHAagent-to-allow-for-multiple-ASEHA-agents-on.patch included upstream - spec file update: add %post to generate new relaxng schema Resolves: rhbz#707127- Fix ASEHAagent to allow for multiple ASEHA agents - Resolves: rhbz#711852- Rebase package on top of new upstream: resource-agents: Improve LD_LIBRARY_PATH handling by SAP* resource-agents: Add resource type to logging oracledb.sh resource script should attempt a clean shutdown first resource-agent does not remove nfs service temp dirs when using nfslock=1 Listen line in generated httpd.conf incorrect Include rhev-check upstream - spec file update: * drop all patches * resync with upstream spec file. See top section for local deltas Resolves: rhbz#707127, rhbz#705763, rhbz#667217 - Move rgmanager S/Lang from resource-agents to rgmanager: * Add versioned Conflicts on rgmanager to avoid file conflicts Resolves: rhbz#693518- resource-agents: Fix nfs mount contexts (fix_nfs_mount_contexts.patch) Resolves: rhbz#635828- Mirror dev failure in HA LVM can cause service failur (fix_bug_683213_mirror_dev_failure_in_ha_lvm_can_cause_service_failure.patch) Resolves: rhbz#683213- resource-agents: fs-lib: fix do_monitor device mapping (fs_lib_fix_do_monitor_device_mapping.patch) Resolves: rhbz#669832- resource-agents: Add multi-instance Oracle database agents (add_multi_instance_oracle_database_agents.patch) Resolves: rhbz#629275 - resource-agents: Stop using '-' as 1st char of log messages (stop_using_as_1st_char_of_log_messages.patch) Resolves: rhbz#633856 - resource-agents: Use literal quotes for tr calls (use_literal_quotes_for_tr_calls.patch) Resolves: rhbz#639252 - resource-agents: Fix migrateuriopt setting (fix_migrateuriopt_setting.patch) Resolves: rhbz#660337 - resource-agents: Support convalesce w/ central_processing (support_convalesce_w_central_processing.patch) rgmanager: Add failure tolerances to resources.rng (add_failure_tolerances_to_resources_rng.patch) Resolves: rhbz#674710- Disable updates to static routes by RHCS IP tooling (resource-agents-Add-option-disable_rdisc-to-ip.sh.patch) Resolves: rhbz#621538- fix resource agent for named (resource-agents-fix-resource-agent-for-named.patch) Resolves: rhbz#648897- resource-agents: fix utility to obtain data from ccs_tool (fix_utility_to_obtain_data_from_ccs_tool.patch) Resolves: rhbz#631943- postgresql RA does not work correctly with netmask (psql_does_not_work_correctly_with_netmask.patch) Resolves: rhbz#614457- resource-agents: Drop tomcat-5 from build (drop_tomcat_5_from_build.patch) Resolves: rhbz#593721- Allow other values for "yes" in fs-lib when unmounting file systems (fs-lib_allow_other_values_for_yes.patch) Resolves: rhbz#614421- postgres RA will fail to stop gracefully if there is active client connected (sigquit_if_sigterm_was_not_fast_enough.patch) Resolves: rhbz#612165 - new RA for tomcat6 (resource_agent_tomcat-6.patch) (tomcat-6_change_build_system.patch) Resolves: rhbz#593721- Fix changelog for 3.0.12-9 date - Add RHEVM status program (add_rhevm_status_program.patch) Resolves: rhbz#609497- Add NFSv4 server support (add_nfsv4_support.patch) (install_nfsv4_agent.patch) Resolves: rhbz#595547 - Fix migration mapping behavior (fix_migration_mapping_behavior.patch) Resolves: rhbz#596918- Make fs-lib resolve links before checking for block devices (fix_incorrect_link_resolution_in_fs_lib.patch) Resolves: rhbz#609579- Make vm.sh honor start and stop timeouts (Make_vm.sh_use_stop_start_timeouts.patch) Resolves: rhbz#606754- Add missing documentation for resource agents (add_missing_resource_docs.patch) - Clean up recursion in scheman output and documentation (clean_up_recursion_and_documentation.patch) Resolves: rhbz#606470- Fix incorrect default for VM.sh agent (resolve_incorrect_default_for_vm_agent.patch) Resolves: rhbz#599643- Add missing man pages (Add Source2: ocf-tester.8 and Source3: sfex_init.8) Resolves: rhbz#594332- Do not package ldirectord on RHEL Resolves: rhbz#577264- Drop Requires on xfsprogs since package moved to another channel Resolves: rhbz#593433 - Fix HALVM: lvm agent incorrectly reports vg is in volume_list (halvm_lvm_agent_incorrectly_reports_vg_in_volume_list.patch) Resolves: rhvz#593108- Rebase on top of new upstream bug fix only release: * drop all bug fix patches. * refresh patches with official SHA1 git commits from RHEL6 upstream branch: - drop_support_for_drbd_and_smb.patch * Addresses the follwing issues: from 3.0.12 release: Resolves: rhbz#582754, rhbz#582753, rhbz#585217, rhbz#583789 * Rebase: Resolves: rhbz#582353 - Stop build on ppc and ppc64. Resolves: rhbz#590997 - Switch to file based Requires. Also address several other problems related to missing runtime components in different agents. With the current Requires: set, we guarantee all basic functionalities out of the box for lvm/fs/clusterfs/netfs/networking. Resolves: rhbz#584800 - New pacemaker agents upstream release * Patched build process to correctly generate ldirectord man page + High: pgsql: properly implement pghost parameter + High: RA: mysql: fix syntax error + High: SAPInstance RA: do not rely on op target rc when monitoring clones (lf#2371) + High: set the HA_RSCTMP directory to /var/run/resource-agents (lf#2378) + High: RA: vmware: fix set_environment() invocation (LF 2342) + High: RA: vmware: update to version 0.2 + Medium: IPaddr/IPaddr2: add a description of the assumption in meta-data + Medium: IPaddr: return the correct code if interface delete failed + Medium: nfsserver: rpc.statd as the notify cmd does not work with -v (thanks to Carl Lewis) + Medium: oracle: reduce output from sqlplus to the last line for queries (bnc#567815) + Medium: pgsql: implement "config" parameter + Medium: RA: iSCSITarget: follow changed IET access policy + Medium: Filesystem: prefer /proc/mounts to /etc/mtab for non-bind mounts (lf#2388) + Medium: IPaddr2: don't bring the interface down on stop (thanks to Lars Ellenberg) + Medium: IPsrcaddr: modify the interface route (lf#2367) + Medium: ldirectord: Allow multiple email addresses (LF 2168) + Medium: ldirectord: fix setting defaults for configfile and ldirectord (lf#2328) + Medium: meta-data: improve timeouts in most resource agents + Medium: nfsserver: use default values (lf#2321) + Medium: ocf-shellfuncs: don't log but print to stderr if connected to a terminal + Medium: ocf-shellfuncs: don't output to stderr if using syslog + Medium: oracle/oralsnr: improve exit codes if the environment isn't valid + Medium: RA: iSCSILogicalUnit: fix monitor for STGT + Medium: RA: make sure that OCF_RESKEY_CRM_meta_interval is always defined (LF 2284) + Medium: RA: ManageRAID: require bash + Medium: RA: ManageRAID: require bash + Medium: RA: VirtualDomain: bail out early if config file can't be read during probe (Novell 593988) + Medium: RA: VirtualDomain: fix incorrect use of __OCF_ACTION + Medium: RA: VirtualDomain: improve error messages + Medium: RA: VirtualDomain: spin on define until we definitely have a domain name + Medium: Route: add route table parameter (lf#2335) + Medium: sfex: don't use pid file (lf#2363,bnc#585416) + Medium: sfex: exit with success on stop if sfex has never been started (bnc#585416)- new upstream release Resolves: rhbz#569959 - spec file update: * update spec file copyright date * use bz2 tarball- Resolves: rhbz#568010 - Do not build resource-agents on s390 and s390x.- Checksum error occurs on HA-LVM - status on clusterfs "gfs" returned 1 (generic error) - Resolves rhbz#563555 rhbz#558664- resource-agents can't be used by Pacemaker - Resolves: rhbz#566176- Drop support for drbd and smb (PM-drop-support-for-drbd-and-smb-resource-agents.patch) - Explicitly list python as BuildRequires- New rgmanager resource agents upstream release- Update Pacameker agents to upstream version: c76b4a6eb576 + High: RA: VirtualDomain: fix forceful stop (LF 2283) + High: apache: monitor operation of depth 10 for web applications (LF 2234) + Medium: IPaddr2: CLUSTERIP/iptables rule not always inserted on failed monitor (LF 2281) + Medium: RA: Route: improve validate (LF 2232) + Medium: mark obsolete RAs as deprecated (LF 2244) + Medium: mysql: escalate stop to KILL if regular shutdown doesn't work- New rgmanager resource agents upstream release - spec file update: * use global instead of define * use new Source0 url * use resource-agents macro more aggressively- Update Pacameker agents to upstream version: bc00c0b065d9 + High: RA: introduce OCF_FUNCTIONS_DIR, allow it to be overridden (LF2239) + High: doc: add man pages for all RAs (LF2237) + High: syslog-ng: new RA + High: vmware: make meta-data work and several cleanups (LF 2212) + Medium: .ocf-shellfuncs: add ocf_is_probe function + Medium: Dev: make RAs executable (LF2239) + Medium: IPv6addr: ifdef out the ip offset hack for libnet v1.1.4 (LF 2034) + Medium: add mercurial repository version information to .ocf-shellfuncs + Medium: build: add perl-MailTools runtime dependency to ldirectord package (LF 1469) + Medium: iSCSITarget, iSCSILogicalUnit: support LIO + Medium: nfsserver: use check_binary properly in validate (LF 2211) + Medium: nfsserver: validate should not check if nfs_shared_infodir exists (thanks to eelco@procolix.com) (LF 2219) + Medium: oracle/oralsnr: export variables properly + Medium: pgsql: remove the previous backup_label if it exists + Medium: postfix: fix double stop (thanks to Dinh N. Quoc) + RA: LVM: Make monitor operation quiet in logs (bnc#546353) + RA: Xen: Remove instance_attribute "allow_migrate" (bnc#539968) + ldirectord: OCF agent: overhaul- New rgmanager resource agents upstream release- Update Pacameker agents to upstream version: e2338892f59f + High: send_arp - turn on unsolicited mode for compatibilty with the libnet version's exit codes + High: Trap sigterm for compatibility with the libnet version of send_arp + Medium: Bug - lf#2147: IPaddr2: behave if the interface is down + Medium: IPv6addr: recognize network masks properly + Medium: RA: VirtualDomain: avoid needlessly invoking "virsh define"- New rgmanager resource agents upstream release- Update Pacameker agents to upstream version: 099c0e5d80db + Add the ha_parameter function back into .ocf-shellfuncs. + Bug bnc#534803 - Provide a default for MAILCMD + Fix use of undefined macro @HA_NOARCHDATAHBDIR@ + High (LF 2138): IPsrcaddr: replace 0/0 with proper ip prefix (thanks to Michael Ricordeau and Michael Schwartzkopff) + Import shellfuncs from heartbeat as badly written RAs use it + Medium (LF 2173): nfsserver: exit properly in nfsserver_validate + Medium: RA: Filesystem: implement monitor operation + Medium: RA: VirtualDomain: loop on status if libvirtd is unreachable + Medium: RA: VirtualDomain: loop on status if libvirtd is unreachable (addendum) + Medium: RA: iSCSILogicalUnit: use a 16-byte default SCSI ID + Medium: RA: iSCSITarget: be more persistent deleting targets on stop + Medium: RA: portblock: add per-IP filtering capability + Medium: mysql-proxy: log_level and keepalive parameters + Medium: oracle: drop spurious output from sqlplus + RA: Filesystem: allow configuring smbfs mounts as clones- New rgmanager resource agents upstream release- New rgmanager resource agents upstream release- Create an ldirectord package - Update Pacameker agents to upstream version: 2198dc90bec4 + Build: Import ldirectord. + Ensure HA_VARRUNDIR has a value to substitute + High: Add findif tool (mandatory for IPaddr/IPaddr2) + High: IPv6addr: new nic and cidr_netmask parameters + High: postfix: new resource agent + Include license information + Low (LF 2159): Squid: make the regexp match more precisely output of netstat + Low: configure: Fix package name. + Low: ldirectord: add dependency on $remote_fs. + Low: ldirectord: add mandatory required header to init script. + Medium (LF 2165): IPaddr2: remove all colons from the mac address before passing it to send_arp + Medium: VirtualDomain: destroy domain shortly before timeout expiry + Medium: shellfuncs: Make the mktemp wrappers work. + Remove references to Echo function + Remove references to heartbeat shellfuncs. + Remove useless path lookups + findif: actually include the right header. Simplify configure. + ldirectord: Remove superfluous configure artifact. + ocf-tester: Fix package reference and path to DTD.- Use bzipped upstream hg tarball.- Merge Pacemaker cluster resource agents: * Add Source1. * Drop noarch. We have real binaries now. * Update BuildRequires. * Update all relevant prep/build/install/files/description sections.- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- spec file updates: * Update copyright header * final release.. undefine alphatag- New upstream release.- New upstream release.- New upstream release + git94df30ca63e49afb1e8aeede65df8a3e5bcd0970- New upstream release. - Update BuildRoot usage to preferred versions/names- New upstream release.- New upstream release.- New upstream release.- Drop Conflicts with rgmanager.- New upstream release.- Add comments on how to build this package.- New upstream release. - Fix datadir/cluster directory ownership.- Initial packaging/bin/shheartbeat-resources "%&+./036?HMT]`cdehily|}~&/2567:;>KLMNOPQRUV[dgqrstuvwxyz{|}~3.9.53.9.5-46.el63.9.5-46.el6 3.9.5  ha.dshellfuncsheartbeatagent_config.hocflibheartbeatapache-conf.shfindif.shhttp-mon.shocf-binariesocf-directoriesocf-rarunocf-returncodesocf-shellfuncsora-common.shresource.dheartbeat.ocf-binaries.ocf-directories.ocf-returncodes.ocf-shellfuncsCTDBDelayDummyFilesystemIPaddrIPaddr2IPsrcaddrLVMMailToRouteSendArpSquidVirtualDomainXinetdapacheconntrackddb2dhcpdethmonitorexportfsiSCSILogicalUnitmysqlnamednfsnotifynfsservernginxoracleoralsnrpgsqlportblockpostfixrsyncdsymlinktomcatheartbeatfindifsend_arpsend_uatickle_tcpocftrhev-check.shclusterASEHAagent.shSAPDatabaseSAPInstanceapache.metadataapache.shbind-mount.shclusterfs.shfs.ship.shlvm.metadatalvm.shlvm_by_lv.shlvm_by_vg.shmysql.metadatamysql.shnamed.metadatanamed.shnetfs.shnfsclient.shnfsexport.shnfsserver.shocf-shellfuncsopenldap.metadataopenldap.shoracledb.shoradg.metadataoradg.shorainstance.metadataorainstance.shoralistener.metadataoralistener.shpostgres-8.metadatapostgres-8.shrelaxngra-api-1-modified.dtdra2man.xslra2ref.xslra2rng.xslresources.rng.headresources.rng.midresources.rng.tailsamba.metadatasamba.shscript.shservice.shsvclib_nfslocktomcat-6.metadatatomcat-6.shutilsconfig-utils.shfs-lib.shhttpd-parse-config.plmember_util.shmessages.shnamed-parse-config.plra-skelet.shtomcat-parse-config.plvm.shresource-agents-3.9.5AUTHORSCOPYINGCOPYING.GPLv3ChangeLogREADME.webappsocf_heartbeat_CTDB.7.gzocf_heartbeat_Delay.7.gzocf_heartbeat_Dummy.7.gzocf_heartbeat_Filesystem.7.gzocf_heartbeat_IPaddr2.7.gzocf_heartbeat_IPsrcaddr.7.gzocf_heartbeat_LVM.7.gzocf_heartbeat_MailTo.7.gzocf_heartbeat_Route.7.gzocf_heartbeat_SendArp.7.gzocf_heartbeat_Squid.7.gzocf_heartbeat_VirtualDomain.7.gzocf_heartbeat_Xinetd.7.gzocf_heartbeat_apache.7.gzocf_heartbeat_conntrackd.7.gzocf_heartbeat_db2.7.gzocf_heartbeat_dhcpd.7.gzocf_heartbeat_ethmonitor.7.gzocf_heartbeat_exportfs.7.gzocf_heartbeat_iSCSILogicalUnit.7.gzocf_heartbeat_mysql.7.gzocf_heartbeat_named.7.gzocf_heartbeat_nfsnotify.7.gzocf_heartbeat_nfsserver.7.gzocf_heartbeat_nginx.7.gzocf_heartbeat_oracle.7.gzocf_heartbeat_oralsnr.7.gzocf_heartbeat_pgsql.7.gzocf_heartbeat_portblock.7.gzocf_heartbeat_postfix.7.gzocf_heartbeat_rsyncd.7.gzocf_heartbeat_symlink.7.gzocf_heartbeat_tomcat.7.gzresource-agentsocftREADMEREADME.zh_CNcaselibconfigsFilesystemIPaddr2IPaddr2v4IPaddr2v6IPsrcaddrLVMMailToSendArpXinetdapachemysqlnamednfsserverpgsqlpostfixtomcatra-api-1-modified.dtdra-api-1.dtdresource-agents/etc//etc/ha.d//usr/include//usr/include/heartbeat//usr/lib//usr/lib/ocf//usr/lib/ocf/lib//usr/lib/ocf/lib/heartbeat//usr/lib/ocf/resource.d//usr/lib/ocf/resource.d/heartbeat//usr/libexec//usr/libexec/heartbeat//usr/sbin//usr/share//usr/share/cluster//usr/share/cluster/relaxng//usr/share/cluster/utils//usr/share/doc//usr/share/doc/resource-agents-3.9.5//usr/share/man/man7//usr/share/resource-agents//usr/share/resource-agents/ocft//usr/share/resource-agents/ocft/configs//var/run/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -march=i686 -mtune=atom -fasynchronous-unwind-tablesdrpmxz2i686-redhat-linux-gnu              ASCII textBourne-Again shell script text executableELF 32-bit LSB executable, Intel 80386, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.18, strippedPOSIX shell script text executableUTF-8 Unicode textXML 1.0 document texta /usr/bin/perl -w script text executablebroken symbolic link to `/usr/lib/ocf/resource.d/heartbeat/IPaddr2'broken symbolic link to `/usr/share/cluster/relaxng/ra-api-1-modified.dtd'directoryexported SGML document textsticky directorysymbolic link to `../../lib/heartbeat/ocf-binaries'symbolic link to `../../lib/heartbeat/ocf-directories'symbolic link to `../../lib/heartbeat/ocf-returncodes'symbolic link to `../../lib/heartbeat/ocf-shellfuncs'troff or preprocessor input texttroff or preprocessor input text (gzip compressed data, from Unix, max compression)  !)18?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`bcdfgiR R R R R R R R R R RR R R RR R R R RR R RR R R R R R R R R R R"R#R$R%R&R'R(R/R"R#R$R%R&R'R(R/R"R#R$R&R'R(R/R"R#R$R&R'R(R/RR RR R RRRRRRRRRRRRRRRRRRRRRRRRRRRRRR)RRRR)RRR)R?7zXZ !PH6^]"k%+h<#889".(sx,?@GvNW9&, %Ѡ[ Y}93m%gㄡJ1U]VaKf\p>V D2)g3H=d%C*PH#T+LՒW6zϟ$[B+iIzlT5yl&ә!r9:Am'_@ E#_dDD'g4:TRqHҭSqp>stIt ~ d1_ky !H~A/D|{LAq,xf\/NPe0㈖ZK~dKm3+T&1“0HgQ|٤XQǓ`<WCڒieU*ULiXvG sqWw4u9?g3@XpVQ29Ό!jUخh^ĆfPъ$o7x8"|i T-]-b].LTȫuEj}X/h]}ݯ$iNQ|uw1D_!3]$ ]ZU͒(ĹG[̯󵮘6+w>$ᡍx/V^4rbŨnVf l G}BUQU`(zjt=, !fER.>Lׄ|r-,Tz*M6)t9!1ɈEcȅ{3Y:y$ھ žGnrW.}n;'8Ɋ$uyΣftKeU -{W7'1/x{fAX3Vi8ٵ<|Iف]weacٹ|N'NƽQZÓ֛gI1߫[9܄; U (mfl3bvKej"3Tw\3|u^]y6)sK0"كN+ 7Ď[ KiU+!dbU&Lf=T~Nn` 9 [%LTw'懖ʮ_r3z$*^ `Jiܒ5l68"?.$86Mܹnc@K\@zPYcc^ޣr-&g!?a2G?eVod93L5YulUfETA+|̶;"'+;fPX!vYR u%,VI\ѹQmXFs  T׷Ln0u9S. Z<%e{WϨl ) >Y 8&otd`?vD^i B0 |[Bj`*WnF{-,g>8l*Vw~-+SҸc08k_Kޑ+ n"yz(،H>(1l>B~J=;-.:z^{QLrr4>z96RX΀v#٩PU#\D<&=?  永!sƓ'fU{rHP6R.C>Jg]h/+6Bp] Ej3ra~I<@o)Ťp혼ꡩ]GFz')K&Beld-pR2:'cY=ad`YEPy=YOZ[g45GB/*E!_PrDoWUw%SN!]uF[?Pw5|'dblL"Py=@LbqncXi(v:KKHV,Z8Ӡce-0Vt15\CtpYhhYvm:n>_0 `;)f wVx3l]'9i}q=t£תt(΍j+nsOF9]˖-Gaڽ* Uf['6߸q|FD-SF6^4`ni͈VגBDr$A/Tl`4cc5"7i7P塁Yɗ|m~C,T[nvn hNiWͶzhdϱD.ۼy{Fb0|6?LߙޒShm_:+$'# e%] ix4k^elZ< o)oS8S hmu[cf{ I ϸAC19%eHA;$$ѱT">׸KQVUVkJCP^: k˪KJ+s2ܬ^R+_yQilxG*$1f ᬾgCIM뿊mӵ>N@!{FmG˶ /mm+sS+y:Пxep2i#fwר6tzl loV;L;O6WBRb- ę%_nJ9oK5\y~4%Rg4MFEyp;՘zj,!|Y/{?B+ˁy|ӵ \]?=Ǐv+D}}[ꔔ PV,#Sƀ)L6 BFłl\ 5_fgЛ=#Oˁ`e)%ӂᜥkSr#H^5y2@6:5%P\ _g@@,8 =./ id{13^qQX/5Kzxŀ<f?Y`>b8T)^ҽ}UJ#|&t3[.kW,=4DIX5Ɍ)n 䅃(o!&L'\L1nZg:7dIK$Vi\dM)[P a'-EJK `4 c\0o޹:=C fDeYFzCeoĎ>͏cF3]\b кˠF5N)|q8OTQwb]yDu_ό8qvMI3+ fv|*P0c&c?]0BlTuSwtlT0.cp|L[^oy1& ڭɪEǞk2FN}L n [xa9vd8zfs}p_XzDY=× ӂĎ?JGq zկҌ`cH72 :\s ΍hc󖺒LR@G=bj}mp@lF"t?Ģ3X=rR/4 v)N"QX%݌mY RNy㗩 p&CpUMXp"BJW]跷> %J3(Rf78婀[9N?&?6܃PvOzpjٗEԞ!Qm?uܱfȃ/,\|L3ekK,JYOE`]ԼF˄-q,[yh3Ji$,@ cᓙkaa>cxs!,̝-3B\Ɗ6@HyiYX]Av]{ (8*L^dԢ f`[>/@@I`"?TY[.?p{-"A c9r"Ze4(Vgr|?!;Tsuԋ67j4㌫!2Es\t%P= SONFl܀IM} Hzuf-5%I،6qܸ1N;"5G:~xZ<0%kbdV>IgҜ]WR=)ՊաYoу.FѦ I8:"Vɨ®B<ȶ@=Z{]D o8ڐ'r![byf%s}|2`8{N]N4m%z`lbݗC&qRDu窃OHAFuy4%^SV'w}~W{'dPq?%r2D0EC>rd3 I]N⌉<+QU1["YzL^|Uۢ~ؐt^f2]Ҧ eG#32=p+!`C!^9!dtlv8E$KG>zF*7lDX,/.@˄v?a_wL^#p`H_|\ ן5UME!AcHT^ɸ^ؾd)'>9CgB-#1Tϝv]1Ewr9o-ojVXRvUwrF{f&sE'"XdMR1 s*xEeO,kiiJ4M0rnfڤP>#T֕.Qp)ўw i"Pu&b` m9X~*=y~kiQ_f,h'xKFA`[hh q e"LhĹ};;m~G_t! s:sq\s9-8@.$Ax @YW2*ܡ^#u UsIJ(]+pvTַ)a٨ڥC0{a(f@C9qYmF@DsrbZnoLb,)q>r~?`ay]Y|*åԛ{|R(af!ro²Dʣ$_[tUa}'@^҄n;5hu nɚ%L ,GZj9;В>0R¤!z!zgZidRƺǺos8AKoF5Y OqM qaQ&vuof8Ti~ç2&%`!ȵ:nj' MYʈKAmowvyTX2>L)oGNr< =.\q9'fcC\&f2,^+PT\͕)8D@0 ^SZ]d5x#C0%ʳ#ƒ$ qds* "dSqYRhBuGa1Uͨk]Sv$b,W72 nGLhⱽY.#mP/hB\6ztxPD퇨gL\S:a_hcQO%btEguŪ 1ju:@Pj6`+$pfk<)SGԁ. a=C xvA9@j-HgB;Hz*"ptW1|7L)j{A 25_i޶!Ej80}rQ~)Ab\X11h31 ;t!\َJUSwde#gedž؁B1)gULv7@! a't!4V7VFizŰP.n4c@L KW(YrT g=8y8݅8F)OiȔabSY8'7ׁv\ l1-fiI}yxے(im 2pih~7v@!R|C櫄.cUGL9ɍbttBG23/ 8a#^C5ߏ'X,2HTlР$MjG)<zk[%=;LjzFPUqۅe9EJ.dRF3ۢ zձ[-qQ>xZQi-D7^qq/<-jP#1ގI0 G&=3Ϗ PG ^B=),,ViIY!TrhB:❕[ 3;  p v:05q7G4+3ET_̏FF q"؛QiYD:[LvIYYWOI)dCw4þ |I g/,}[ C~R;b|HwX$侶~0]Qfʄ`-~ H*@ .K!,(~~O_ ^hV!=ur|v<Tn*)<\g: E^PY5fh`/$_5jJL./6VqxN5aVKɡd/8Nh jfFR;1Su'[MElGo怎wyG/V?yh Ҝ;Y%(3˅QwmM0b*f; } ^݆$2 bn1 xRg=|yB?$ jOuHp F-Ȝ/tQXǫopfڪMWSv e,@gY'ʴszy?#s9J5x]b;kBB/‹J; KRtu`{cOPXf@8 )-UgW@8(t/Z c"a+wlS OY8q=IiClL'|=p&F ~/괤:eȮ-fmxg i=XoM=xj?V eq2 Rɼ|}}kBPtA({0챵ݨH-fUfX_kZ$7F+L+fa{#blͫQEtC*t}7}dE e.C^X\*eLWou]ܶ =P\K}_Xb]q;yMӰewYJzf>sj& ۳5js]`c| Qbkt?w',N']Ib{7;ծdXQxls36$'|{gMA,EL/G<$W·pP;SzX_&X?Ho*킻60,aUPVh VΙO#7i/]D;5Pz Q2JcWr(Qz@,@d PZ&̌!`KxǹAGD&fsP/1%P =Y"\uA[!l.*wd;CW%L;1D7)%] s˒\K(}q3yqcD\Z͛9Ƒn4;ZGҠagut`D4g>ֹz#,rٕq| uB#,e0FquJ5~FV/;q{he;<0.\t, MhTywo$}+/œg}WV;XQIdLS'z{ī\_7nUIIp7l̝N1 Y#;֖YZ\bmfjF0s1XgwvUTJI8ga,1V|  &`H{A.:!YW{}G%b& }}`OCwTus")W 0y 'CK"vi |_句ZYv2V>!?v随Ably\h9NP5|L"mj__G zBQ6hܱoUG.dTSSc |.ѳvxNw½^*%[heR0@|\ JchK&?!S|w"h! rR.$:q" P#jj!V\)ro39,> BƵf'h@P n~8!dHb^zi$F8Z<1>cq⒩K"==%9t\*U"!rvVm,COJq}i,EȑP5{9䜾a?B`aT E^*>eV S*xX%lŧUș6ևl',V꺮&7%WN!i=h Fϯ֚5ANޗG,T=# 2bUWs8$8~H B~? /# l3S(aAZbFV$cb cE]yN(nxXFpG7ƆAVT/=P[%#rQdkV9 >~z ݳBv4{6óZ(A.H s]L)0ϊ+4 @h?ax=<"  0j2"…61Dʚb!!kmK=}p 2 e6r:?";2Ȳ{n]5h[W:ndny]=&:DKv0,뎪Id"Cd۷$muDTF\)6ctG,#%V QBU]\$yTwU.WJPI*JV jfADQp.Q`axX$#NworRLM=P-gLS4v4Zu~0YɞtTǫH#mE J cSi^7. c8CҒZ7@J ),oz']p]ZZ8Wց< vN רN)u.>s>.˹ mWV@MJpĿݸ^Rp>FωmLUXTM,D*Q2.åQGy"Aʢ84ǧ9ϡN|ۀQU1և+aֆ|-V<-!`։= &)6|pCѯbpj]PWr8H3չ?^'UIΙ,5â"A?R\z{*>+l\M)Gl$gJ>[T! er")ud+s%UGOz%@LzSi_ >Kg\C: WA4_|J=-]t `R$?TS&9!YE4Lx7UI1t %~qvf L!a:٨4I^&­۽lKsd :=E$Ӫ[u="xx&Ru韐`cf8uO^RGtk9"}Ϝ^!cq~4pVJ/,YaGz|&mL3co1O^ C`D@@b)0omLķ/4E $p: ,M495gi)x$a$⅟!aB[YjncԯDa@˒h]OKE4lZq<)V8Y 'Ay<4>t ƺlSIT%lw֧\@;ؑ\C]#$֢]L@67_s4Tnb2AaiWdGpX'/ OE.?Ԅ(U<'/7Xk$v 6"QR߀Pɱi#dV[fܬ#0T|xhRꗆ Z-#8HV 8" jSqT^H~[Ǹ9{j=ZKS_td1j:x GSV': TәRi*ϳoj=s3Nz_7zB$NjkN7BJիjPUZmA^R?0SV_F PiX}{}4_ s!gĕiƳ=# 9Q5%bU" !KK1EpTYeor/#!2< YYy ̵ #̓2 $Agܘuj|* y-ցKL˂In5\$) =u@QGt/U'g a:Py:EJQѡACwtkCl]Sl81uCk$^~iw@o.hHRS!s6y]>X"*:,0Ba;(]s}ҍnJӋ"#HZDKOYHo`J9QO[< .ݶd̐)#dH ' 8ѲȆ;W=r&4ׄ0^ul`:kKq[yF6 qk$^Cz+F~c? S|vzqBLa1G yq=48KK *~Z{O0jlQVWH hF'\Xmy=~LY V,F4qc÷j”9ɓBc']V#T*OѮZ8ٕg4_ޘD4m{Y49mfE+m4,xibk&. 0CI#k/Wp]RU+"MDuna`6|R6ЮnՒG13Lc J>=SbcCz\35_3R 4Cw*єI\Ǖݙ"$̔yħlV|8(kݜi}9Ԟp͍ZI&Hؘ=aYt#986 !O)ΒmBLAK~?zuՔz2 p,:vSmsD0¢_,L}VxLT=YҶ1`L.JhkXA} 5f49VT1:֙OGܷ8\A |38n_ԉLwIvcm3&:dFq()zhHTP8+p+KQ?ȼHB: fDwx m[iY5KHS+jEd1v-8ST(%J8b覻)+ie >SȘp\G| fzfjQ'7%8$7R~l߬K!Tytj2!@Jldm 6=|/x/(ŗx7sGv[f r =V̼*}yE;/w-Z`N񆃬ԔVFVZEi@<77&[RuwZ~8?F)of3׍ ]I !8**puh%$~7,v0m&Miá_*ގ 5Wn6 >|TM^y{?'ZmEݥwL`YGF hVtxYI]j^f*5٠-k]#^yC"(u8'!7K4+셭^ݐY`Aޜ!s^ͫ9:,샠֎Wf6-9߁+̆R|ꜙIr_3%@2I[D5ޘ).Q$5jބ.Q1XcZ(`F|kS`zx_> Bo&[ڼͺkصOTzL`3ؽ'8 D~<%Qj1 A"d` "[ˋS<[V3Fw3_qflqvIc2L~82ied)83.ZȌY?2Ãl&4!-`hzl+6Q`w@Fw!Xؚx%fLXxGr 'P$w׾Z^IhL/=qHiI$r#hjCVM&06|\Q6J|-b{gv*nh1>l#Y/r7U Uݬ [!pH `vO,z"xR~ 'g\HTԗku@r"0Z`36a,#&sxZd3u]#}^$ʩ䠴b)~8eH7-` >/>k+Z?P;얩^{CJ}j;Ѧ!Ȧ:*,]YJ"!AƴM+="_㿯/-)N(1(!5KH͹"+gI;D[Xo5Cpt7,-ǘ|s1eRٝ\بML?-s8E meTDr.C%:MǢlO!2t/)qZS4275\,#P-[dΟr9(d uӵ}C[F^EË&O%󍶒Cr-MnUK *},C i #}/Yi!P۾MZ~t]~,3%vNBOox@qfZD4>'N:GŎ cKˢܸ?P:&p-5wIkhsQ<&`@&" /h~omXeyP:Yݡ$‡6$KQg+ZBѺiW2a\0Pq~֔#C䝡?Ď5,:;ʝ'cHVx4X%.^g@ۂAJ.нŭ)eˋ722YƷz 7MQqYȃhnM -am؇A>fJN'K(_GVLbxNkyt~% Ig!(nKV :φjWJga/N ަ7wQ?gܻޗɿV0lZ#5VGh3Oa!L=uk^kBV)~!MSj;p0swhp'!$k~jHu&a(]# Mq7F7Vì $7ezVȇasMl B3iur/}o~r m%w9JynGI;3 okeGW>hԽ@cPijihSM|mp沞A|m)3Q A’9 #q {kUrq T[9O˷y#夁^3շHw:Dtzaf#_9 R|1v2`K5ZpBY ԣ@m65p0@+&ڥݭ <3UR1eX|+{7l@bH3~HSŗbOv2uqN֚[s 1y m)YFܲo$h6aG㊐|KqDge:mT=t-i8faUi9aȷʩ1WE جf<%P&~]\|zݳeØWk%9 ;x./NZ#Ac$$=BU$顲b}S$Pl+4yB w?M䎆I?G*|b~J{fp:2+8T3غ \@QJ / \hrsԯJLgKq!HfڼcJ3 $c'mǯD qywFuT, c\=\)Č2EuA 5g)"o^M+oB!6cWb6P y@$i.嘦v]oɮ@cer14UuL@-Ƽ$rX5BȂL=j`RVi@Ί0210w}ԥJ࿵`R$35RxrmCg5gI7T2鑨_jK}~,WN!sKPh1 'd%`xu)<p/ĺ =W:K;3•HeEaO ;M3jirxv">e^¾p@Qwh~ OIӣ?K'+.8׊p49(O,dC-PϞNH[ h-*^d6-O U9' ,AZ#%X8TdTFP~AB+6<ќq'M5l>50wO ^#~d#2޸2~e̕h/Z U&OITe>zA͎;н%՜s1Ac۹ Vwyvtﱈc0RͰb"I~BjP]݁3~F Ik%׸ |)G-aJk#{> I|_*g/iqk0x J`~*4J~"i+CME 0U/T'~.ͰK6UUvh&& = !Loam2zYbT~IβBPwvzSo:kQAK\tl,tDՓ˨^Z0Y76_sAg^P+vv&A\F9]4*&c9ǶOSkZ_:3&_@`$L`LlP^/_~BM /̡$2>h*&:1]ߒ$ӄ+|r:z dt}SF*2[w+IL xMWcscSjcg3rr&Sn)ga8'}_}ĿUzbc.IK@)0! wAklݗkw MWv|$H$s$)2#͓z\ 6~N* x!h7^w 1"Z)(he ȏ*KP/]WEkB,Кg!P"^l4lȰPi-X/M*,\1JZѻ#H{$+76.j\l]4%ؾ S"[O?RT3<%ñf[s kG&b\Ea& pBʉ6b| fvDAdOWV۔۪DH-*e.G$8lL䐐cGMRK1y˩tf=S=N?#afE99 g?#S6~&&`~41V K>uV>@`FY+#yY1!p/[b `׺΢I s[kT}.[ ,BjI^nAp̟C{ EƧ/Nj:~]NFZ_E'x`~ Kt㧴zu0H .2YQ{^ 3BvўaXM(k}v <ư> ænMZeѿ$zɸ?G{?n*Y1-V Z3q-e ǪTF%9aX@@4GTү|ુBGiVZ+u"_NrKHSl4%NO'=)Yt,3ur nɬ;E8&y=`8,`f M6YIߩLZgt` ;zU@ 9>2UxL8 DAz㖎jOZm\7ь#a&23A ~E`N${?KZ-/@xnPlPp[K Ih\o!hGeE,{eA', ek̸%oC+WVku4Gdjc0DO#jN/fzƣS9Q/0G4HN4w(h*t ӬJ -Uj :PZ(iEAOMZv&w6J 豬8QoN" U描pCQU/ uJBeY{Gc' ѽ bW] PL@sPC gȃ%TΟPy_"D;XM_u?A yĤ?z| Mxg5H 9i/v{IlD&ÿ>O^\K y"B7XL*xZ$;&״ 4,ڿw歷.w_U[O {3^RE|.\b*Lwܨ 橌-^x)CSDSNtuXL*L ݗs9Y@͈K -v u~gS _Cp*tYA*cPlTJXqR&Er>H˞>rSŞ琝,+lj3ET'F%sۺ1?X7BN`ɼ-fXPq2TUzY>\Jt5D;NpO?>5Ԉ ?SiCۊ܃}ӘTD<ꦜLwRi\ \9\,_iW%ٷ~5[+cz l?XG #w,Vb Ĉ~i˟6ZɇE OәVR~Ni^-a'QkQ*qt:\Kj'zGf9!G펍Uęo⩰X~Ԃn$ .vyHV8LwAVby'ش3sy B=izfL~qu32սK8 !d G+ :0#A4^ |";U3Vv坙ߒAVe'*H]@=>x?n>0.ODC ,giKWH%O +~Κ.%_7W&A֙VQ5́9kFnsS ᾈtH' }Met#ߊ^iߜË"Z_SEn.I=nHŇWqL7U\vwȄE ZGh^}_.SjHu>Hu\f1AoQnv.,hkwySg<}U"wYBqQx``H󶞲ZSE SW}Qz H3h8DN {l-dv7B,dl/g8UMMoj|rs/ql'-B W9Cs'i{\n ?AEG]6DJTWyW\#*ifԼ8oOCuDdG|E"Jyօ_$Q mt[Z&y1JOv߁X\Աheb:̹V#w%6"}4R7>[ٯ@ݠj@i#+{G[1T9榯"YѱvkaVpJ-\\fQϣlY6KK9q ml .[7'@IV[W:Je(w1<[r# jS9[#ztהQt.]%SQr2;`y,T~sӤޗ?@|`_;f`AI>,JnghRzgs$0*JQTi)qؑ4D  ;1)`fI@IPCGejW䓔څHP$p/Qޢ9d]b38(F[#IpᑗEg"L:x@vfM; |N(Nɪdl3(4d!wƳ*e+T)!kS¸H:pae'{O;GsA`& Y+E/-ͥC<8w{Lp&%Nf[-N7m0L^]L, ";ahc)ׇ;kuG#h>hfM)*`c _WPZ.R"*rp%% bz *HgJE s ^QM}oսcQK{}H4v3=J(1\8M_=h{>/Qk#S |J|ODmO,u|?`~'R>|+ڗQ.@ gm2!wK$ ڮاe6[iզ1 j9ZT)ͰN:Xq#GNUtvFEIxkZ".ɍ2أ|1 Z/¡]pF z9O6x߻c Kw=)0[~(Qzگ@a2pOXjdՇ^a#S)EۼvL+%/0K+{$f2\k kdҰT}Ĕs\>fIE~9?.ApKZ"qvwY0qY0Ѡ|Gze f  @qϾtCi=蚒jq XuvyM3pT|"vD`$eY0":>D\U"T]2ً~Ti0|nAŗ3|RxAu'-$P髛YPD|'Efҷ,lLEj[-޸Sʰ#ʜ]Ln; 3=ODt"79*X v:8(-Pw4B.|E&)ZE'W!ۆӁ26zǞrGO[F;.Nfb-6=,^qG\WCsLѭ?ҁ,/.9/"&!h:XXq UL6|v)PDP*}EQ;{C&Hr(knDc߅qKeQ;e^du)y3fOmC;c̸x*QDYO,\:}D߇]{:ȿyyPAn(Noe4ˬ%n ŰVrўF)ŁZpLU}r+Jlfw Ƃeb:wj3i>Aw8N}J6E_V[m|K[/'`cyC}r(&'эOߘEJDAkoL12FZQUaE̫'B7h/Hx d!JܰjK >~KaCdKW<7:evu gG`)̺DKlъ kC]ñ]]ƛleW}8:ZՓ;7Q2 :rsT4}3W#E[ 9Wq %] }ݳ)IÀUXŹL9S?f i*'l%6th`%?1o&E-=lɴ~^~RάQ(kI}uB\,jZk C"pCBZܜڽWjqvW9Ӷ֭zl3JIUR9;v34Q5ԡ૿Le60yWKmZY8H/~\MC>@ /'IC." pD7oȩR tz K9Ru=&vJ9eΙP(fʋTODaMtaǮ".IZ6=_nL%7nMa.%`,o6b0 DWV yyT:3w5eE7կ]lo6eilFP*6wi t( rOOIB[œO CAB"`sl^iW1G hm{R97MT-8$׶c cYvi_r_E;@DE6$SNMP9H~6 dKƤX*RO.O3M DV5$Ur$WT$;$\0h=l}B~Tt*鄀>nJ(Ϣ'+&]c)˖ hhU 2"VQj .<{),BeX~ZSw;l1pFi!jf!r01(t~%qݍ{%q6u޾f3ѭW,*ޞ\xͰǨZ>k{̓E{G a8U12AhTڐT$0EDwuѳq>RӼ#yc\%k"L pXAQ%w!Nc9%v`.TEMlT?(#.>`hqsV'$͛^_e.+,뙘ITKZyE"t._2>=oRFe9%6tfSa@]p1Oi\r<ecTmm-ZX ;W& w ơ}wa?:LRNX:a` Rg-ʕB'P9 [=X=mS;V8B3QWRK|5=YР96&fr'xXZe-$1jBy@tDm!D3UeАWeTAڂsI_i6et$idh/$ #'8bjՇ`&尜j#Q𦂼'}8D ZƀSRZXD !WKp-ǠmKxtb(Pt(.V:x9sM?>>!A|4 HXn it!o)#,_4rX6~sRDU1PL$),^DuZ:[4N.>*A22v_Pf 't<Fԭ |o~$޲Zu+ؠ]/*6΄7J Pm;)vO*^@=wzq)_rxg>m =Q,@ک{iJJ? h4T>h 6(#4lxk v|BmS[m54I|q܎}PKH˱Ӕo@ a/YZ+&mtʖܷ.ȀtJv8] }1Φ!GD:@:} Y5*xM w3E!3ΘKLwꤾ?Cohlc&{Lru~Cu9:y3ģy3?苺31֮`47O%Z~WA ,h ,*L0RD9\Y&ehv Yn ے%7)mq5 B"fvi7;d$aj2cry:nKEc@YqH׸TF3;g4?η,_&6O"x|9nۜ ֤nq0;} >fI{Y[#E~ Xs)Uޟ@mtEE1'-[t#1|ꗙ M}Em'zԅޏ`'V#ۊ?O&:}ia5!KʔGo`)w*u3HMLy6]ӖEE. P02|܋T8 ٞq {MULE<ցdA\=b[>5=;ҚzvEؾڻ'qFpv,B4(4)N5@ ؼv 񽤹sL׃." n;Y9Q lQȷ X6zD4~tu3993?;܍4$'A|Uk?ŇKPf&~K !aϙjšrF u;?y赻h2󆷞wsA 7Gcd&"p$0}ڄYyT>p)!ϩ..h׶-a|gZЯ<;2)> )28ҕr[eikfѰ^IjQ[#\w^5kagH_6zt(WV򠃓$h|]Pf'=̽_ .4 lAkFAM.8:_!(a?ҮU{ 3¾pFU,ʊ0lsTqFw. KYu%0:([iʳ"Kw**bd%Ց!XeE 2Ck2=$.&8RgMVvԯfw ZB31^Uedt<&d^_׷O޴oӪːh}(,SwKjm w_tiu/x/~}۴Ƅ*7Ρ!*:@HuJ28PeAGL~G6 @17VbA0A15)Ղ!^6CM>h7P5|V(z6,W[hQqjfGCv^ 3aiw a _mC & @洶ahSJŢ:߄;L ~, ]¬Fnݔ}|_Swʇ-xQE، ɕB4QN,v X[v}n|lH^hp uՆ_ȌQfbZt6Z܉ҚDڅ?U̬ %t0uALyR7ebq9C#dۿ|%*6O+~j V@'LOۺ\S!@5[~8˰k1ԣI%O+U*i!&8M%,m0kP?-6B7";Gwd{~'Lq{JMRj\yF) D N9v# F}~ Urޯ~]J'9b;ǰW &j~٭-d!3_\=Y]L 6P\B>._w -/[QlTzY]zw;Bl/,WmC+s= (!t2+r?gqFzm5g,ȴy[޵f\mRSLgюn[@6MUKbj瞢v`|*Pz5ujW,X׺ Ŷ!_Ytc k:*h"wDK̪!;ґpuZ pfgeo^yeAc /2#_@5Yլ!4PO,+b" ?T~Z]D|rU_#|XZ7Y`A-I"Fa3te$˒h+yKPFFtmѴciӑyDgptj/"9EC MڟdDx.|s/xJw52 -6*8lxd\f{ aE>< 'Tԝe)oܭO"0ʳ9lU+>v@.)BÑp ֘|Vس^ɀEx-y;=et=syzwC(S/4oJT\+dROk?Q⨃}/{ZΠ!8XxLЍɱ٠?B.,|H+3D"zB@]Zu}p.>}P_3FP>rY]?<YCzlÇUc++<‡NQ7\@ ZKnCo11j@qMtGHr˪="8b%1XrY3"dﾯ)y(S +W>'ZH.(Y1~5d`ls[E27rW0,~Os {l;5VU劅r>Mhb@|Jh/^B5$~lݫ!lJkVu{v9k;/C/Ҡ@&0B3H| jRAڹ@K5-4 (Dp5kzG 7NTov $atɥ o vcoho_Ï%B` F,>|RP+5`'Rr~p.dox4톃xrԳ.#*R "|6jNbQrP {l3@M#I[ =-\sf4z}QPZ r NrSKc[)*AO,VDו%;NC\GT[p192)NWr]Ճ O՟בR譥0\}t^pA{eo#VFKHqaV$/(Y AE >r6p2 g|7n;bQ qH5ۅ0leV q^YN ˱.TV@zhz]V(PU*̓S"Óւy?p_)0 ]z $OYo~jGZ:#Cł jX<}0q$j`%K {˟!Q ByC![Vi wXxEãaDBcզq)52i;րOU%k]8Vy.C/oBEk&F +vGrSc% ϝDj\8ЧǕP &K2fuALcoTZva4ܓQ.qY!Td(͎>é=Y\zJ"5` ?7¬ok3V$&u^ybh,i;934B!)]zH@6yܓF@EҔ&=4B t]@ ܆[,-^OoRʰust8;#UT u=q_*] V ܁&d2%2\:`EgA/-4k="5J6)!^v#Z9!l61ʕ _ښ>s喙&,Xb w=7iG0Ʀ])\5h8s}BGwGc}W]`ߝ?<l%gO}kNp88^gLt&Z,l->>YeXR:Lƿ%K/X2+) ƞ SaRZe &&%\ ͙6-8_P 9f]8xYX@h2`EAdT :|qi!Us=6zIFpkT-u/Sec%"I D)Nkw+ 0wN:zW- ȂVH}A۷ L^^_ dŸ榌stxFw:˯.3q51>PYrmBg佹?h.@1*)G s is6uժ3 UTPXZG~?F+<8ֵ!O{f8/ǕGk\4+ *6-GW @ѕrwjN@x_ڭDm4\;3ufDVA=ay%ٽ[XE͘XKVM\Zf]Vz;27XS"Aq=Gn I {eCvв3F ^I;20Uw^aM"$kpoke S њ`dRVw=gskk*G{"qǢIgk ;"'H-8b#eL#s #^ +mR{ Ybsٖ崋$pw}HHy.➈Vn&a8 }{8u3Y$[7(?!CI#N"FPgsit_Qn&)7b gۗ&FM7c_>k0hI7DvxlAM 5 i Uη]=?` M?1ڸIE *57їb,G}!?r'PDZ\v{|?bGne/-|F7m݂i/s>fr>2hyMUeCQFpP^~F}%O[kQ`ݓXy}eTpXg6ak+ q3@F:E<ֱ]T,JJeSeQs,7TjO8O,Y;3]]Ȗ9xbgj/Kj\ 'zKhk LD1D{VK\!l h .nMw QE)p8$rXa4k^Rv Wk]-1?łݟc"D]jn(^yR mD;W\>W@@3-Zco{W@c Lۻx[hwp48O G}({ah^;O8n|c]D+h|6Ṯ vpLGb~g(?[dpy2VÉK#+Tjܪt;UF>y.;uF-?s ( @Fp=blPxʩ.%ihoT^T(vf9#j*A|@`jp{,Ѯ{Vݥyî䞉5SEuO9.gJ % ՟qT]pt Rd0"ќGĬ_l]Yw})"e WJ Fpض#n|iGA#RTsʏo|}#rvs-M&~KW"nh~ݰ9`,4wA̵hlSFSσj`r.-%,b[A ^( VY>|SXpr27!%ufBgYYw͔|317w^wRrݽؖ}F> @&uȵD<*) ӍnOhaw4DK[ v "j+Kۂ W,M sCfj=itb汫B?`'Ps8Jђ/ ,g{+ ~3SM1tWz .hc{߫+($jku~^Ax0¶OAE+…OxA+2r[c/tD"ɪ[(z{ E;beJduM#YA !JeZB :sgX)Ac#4 0c|b0pgV@dI>mqz>l ;34ܳ>F/qTT!th?5m{ӟ KH 섺N#-\[L `Pyw1cLv‹ DyYޕ[jC6QaIKC&d41פ+:M!ڠ{HfItΉ'qV685UQ -qQZ޻c1B6k c0NǮqakq7ˮ9Bh'[i ZIWth)MX80J}++}ixf~A4 4#r&QZ mH O0TozѶks*({u'G1D-? U$Tpˎ1Z$~%\q,SZD|Z`/+`$Ŗbf?l<侑`ק@ 82rwFZ=.Ӽ↬. =AU- i#Ke.vȦ !;LMlٿK'5FH}!`Dv%t@2Or;~O#A/kK4u%( <6̊F_8[GKǤ\ i3znX5rQ+b3&`y𴝖wM,9 [܀'Ƥ7TyƮT&FuG)'~~yD %7wJKdB 5!4I:%@ XL2~o+9ߘ؜Ih΅>+ {<ŽajD&m{kgk`0e>8Bg>^#!].<(6%^YTc+Бuΐ@2XILo3#]x~%BYpDp5tT1x>\z~rxmR ~ܲjCtRIUo'~ިki7詨G4 1,cysr;8Xg &I2,FlK# QG^z:v=}=M`۾.w*Ա[VGb42˖R z7&d7[໲Jˌ7C;С;#ZԖO3m `~`K$ `TH8`b]i梖^eyWB0ݹpcY$!r/9}pu-)Kl wASrAn}bߤTm517A,g@t4`n{wpeY#+ X|9m ri9(}IS!]'-/{sX`H(WotuC,H)-&tg xPX+"FZ̩'CӘlǪ >l2 ;R۸4 rBׁhÙr63=338.vԊ=Nl؊YU9C'`[7"0'|"[/OPn-g%CҟGl)#[n.^a#Ƙy+5@?K+}! fЄ<`oo`QcgFCo&~ejӽ!?,`:n@'k{@bߖјa*EyPrOqHV镍@%t?|E"ZVU{JqA|srq< Nm5Ù>_ g85ʛ59ᰅD*Me,)bIY2+XzꅝlBSxRֹ?| u2;_+w''Fp9/UFQd]hZbg'P2!Vpǹ& ZYz`b($<'mW:VE4/'.Q1Bʨ=,?{oXȉJ!YJu8߸dN\/|Սd,uݪA+25`Ջ3@@PhH 0%f_V3-ܦͽk9"JiGih;gI#䦒yݓ2%Tzy'77|o5m%9FΞa] Bm­-r+I+KfQPL^LFwA %Ә$3e``_?9H|c^!gȶMMhϖe,*!K,0A'/)9 ؠAm*<E x*i[6O}?Go E%[ºѷf")FdO~S9ٶ0t;D}OVT46g2,70PK%՘$:i-չAŭس_zp.5gĉثSa' mJ?V|I'Rn Άjo`<(zC4.(kYEк޷ر0Mm5ŨRΞ2 ''d\ XE-"k~^s7.{6 t^ roȑMhu VR=R yB䑈 NVx-qzs9; 1~T`<ݕ.p"!>ye%G-(s=\cx*<$ܮ FO¥Ŧ=b?'l%Z{ ̢9BMxD=+ȊW,?ݿh~}FTiCc yQ{UL5gU눸XƂ`uʍ}fz12͎8}Og+l88t |e+$Fװ5>k.PvU @{lC0 TO_DmyD9BjY;>YUbkHeo@PY0ÕF͗Qpp copQ"e(ӎU'9Zx5/G}E|.=׀xq ;Y7xEFy,sb'gbV:G< r}ƠڸT*-q@˿&'YCs2eb3EA uO-`ɡ3E$Y%Sm(7&l1BsUMPr`Z 3֮bө( u.m븥ĉ> {)Jܑhu]'tcjpЎb z嫰pQpZEեِB]S͛s砆.3+nꠅg@`X[)=SHJ"Dbs =R E~`)^Laj08dİvIbd u@bl9,%Vą!//.f šGB'zG*J$ىbё>,CfurrHFOf}QC&Vi  z̖=Mroz@k9=9U0HI-i tYFDy\{rAg3 V%7yh÷m`Nj3x hy5U?9-Ϸġ1 vyvZRFdg)DI҅`a2CTף 1[KvS|.TC5"DV a Q~"MxC={|H.嶷kn|=FGϵdӗ00K [fnkҮ8dZzפ\g.z=r\!){,zIw~Lȯ$[y,3]xշ׌h\:ZLKmT4v x)]$O̱ ri;H~q3G`Jm7Q_]* b]4qĆ8ݵ_Ly `Ҹ$H5nM U{D %SnH"{"x+REF~UW0o%|Hu!Im\KO,=1| aLa6,-M(;bRLgLR(R(%W:*1l=235x9`=9.!vW+C~ne;&!`%:=LqozkV^~\'oUL]. /-$>PmԾ3縤4)$ jVcd(~i} ^M*ek@$4꾹f[nϬE"槜h:ukX>7@z7rX0 a51p}uMGGi@禽]v`w_ A Aȿɿ gY킴ۼ^LNu?{ jb980Q}r. ~]pn"yyQ!Y+ބ ͥ@ZMQtđCb,/ ydb*"sYIz 2 mXl4g '}n|aeRk7~ bgrT_}=I/ꪏDO7:AQ[u5CԉB7x:_- ajڸt%<ۧT9`L:wGE*%gyDe_ph/dc~RU=?,)@IB K.2/nT(YNGf*Zq*":Aqy? Hlb'~Ph@MC(D8tVXa.bué$GnJEme̓-06VQaݻ;ơHY& <0xt*^ ݽm݀T'zgIl&uN4kPDb f0_ a{*5T91*Q_ 1 {Hu#U~L'xq2mܧ(1e.R*fB_m5)×@B={F9z':1E%oR&Ľ?\C% }A NvN992o'+ Ҏ/fg3q=6BTS5wjwp{25Zvv@)lM}Y v`&̅x\JIo<҆cۺf1VS6VkLͶ\^,wxrE ?DžzlnM 6mi˝b7Y6x|w]WhfE%t UAw GBƣW )F9; M?ENϊ;~{OB3 m@\t?ZCa\)R3v}55OSu<<GZt ]y"JkJ^9jsұoX(ǾJ%my\2EkCEo& QDZ˟m$0ʋi 3Wڡ#7:jؘvvXӳr=_(MNRv `"0ʀs_ ;-ڴq_NV ߖzY%~rM|CWDQϩkFECz0iS{ CĦî"VI\5YXK\yQ [9 ]> ; {5L_%SVVɯ3Gӡ`yҼz304C]W6` v&m$lN%D5Nؗ *Ej}\T/m[mnPyyi~v3_k0CG2O>ZX'xAm ]YM cYI8&2ugƬe "x"U3:"cF2Os_ ) GvU79U>|J VuN_ϮB s6`8Waaaqa󬋨N]jKq8l9lLzY'Y M+0jvs\ٵ Va ^`%qaCMd^L .4E!|d_6^ 1 2;͸,a"ມ>BN(?@R?i8fVYb|'  K5c SV4M`LUy)ኜ]3-oϣCܟ{COo^RGO_Z9Hۗ߫')ed=LJMua|06q"&\@%P^I+T0Wg?Cm>J{dž<3(ߪǯUh9IQF߼zUV&~)|]Yn7Byzu<33r~= π|lbiC)=lwUw9.-̡ݿB Quŀ,OcVu+y7@ټ*~u"?]$m2Mh./h`b{t@h[*̊1J>FIprF&܈}^5*@JFI±pI^lK<Nm"2hiUe͢ݣEWtMú'nl㏟|ϥG.E#Xyfc D*Ҫq؋ެ^Gujf}^Xv%ߋLpB$p5SN i7 C#?UR̾T{6ōŷLQn \;Ψ숿]—޵Xt||o#p;ͨ g]&HL|% sPSXoAp:8+fc$3ߐF( {'cf(O] i2䓘8~/b _G̞j1؆j f>`Zؠuwaxg9ʸO*u"P)V'xs]+ \:ڨF& `#,46SThaseE( B-+$}g$﮷kMZ1=AJׄi׊9- &_%_#wi{MxTxb<00)l@)1ɱR뺱K4cëCAmI7m Ӻgx4?X<~F]!v]o=qQ~+K41Z28Аfkl,c)E$ BP<>UKSgA.ZD0{0򨼴o8$1Pk8C/aߦm>? "w(DSWy 7' laq&-GoPo;?/-j7A܍^Bj1іb rkaz>,rZR}JcrG})qG:dxWf.D.ooxЙSeGPa? $B+IH/PJ7ǵqd>CgRgcMjGY7;-j-=zfe5Fa2k9j-(=6-AUԙcuA[*'TsfV}{qy4+`[bL>s>ha9QLy4zu*G-iD!A'І)}@!vq*6k' fL. 4`@eWdCx 7Nj?o?y]>9D`bwkU%S*ny.+#lV  ;yn؛V!)*ڶ\OIn1aw-^/ڶKSR!`Sw곹erQ?۶Q#E}0)nQLwJz J|x™I W}=a JP&hoqWךDHVNk,b~~_} y+f>rWV{q@kQ k uHDܝY[M@Z}X(2[Q%cy%8daJ,r7<SOp2#lj+U"-n>baůvMd=">'/X1%i{.#Q r߄٬2+׵b[$7&Saެ5 X]:F4gUs1xs1Ip7GI9x6J&lL搪)J[*)w:󔊝:I8ז_(i)fr3(v:3җ_kD llț/s.ؼ:؉-XC!N%X*gw{Q%vb {qUj_b*ieV4;54L9 ršv[.ri'(6+yӋh7n܆ώdlP4i,XRWA{ ,V$E!ow5D< \>2A8i/DYɁSלHçάQm.k+LdvqWUSUx+@zڕ@-\hb`GsFq@mܲC)7g:L o@u~E{s7QS<ǘ%7]Dsk bi(+{ ?򞍠V b']& Fƭȏ"_ڪstkp'@7ċp޼vU f\*<Q'5,W%:QlxEm0`X.-i@0,]l #dܫ=F(r۸_㮹 N*;,C#~si+lBSW9R j:{~ywir7鮝isLW] :4"ڿ?)=QZ%ƶ8}tڳ 4 hA([) mÊύ.ϔCeB!Db(#͹ͬPbR2~L;!yx(_2We`d_UM-g1s7q_MdaRlyL5JP~B@)R݉lcjC !p'mnb= KiYtªc{|_~ JFU)B]6Z|(\E1 NZWB}ѥ͂=:ۖ#MOAl&QbFkYf8)כȵ_}WPs+YH> %܈ׅY?tڟuEΪ5K=ugM&]|㿉~?p@gDg7,h_@43(E?b Df;D ,^Q9,`Xœ@fJބs(ǡhOd:?aeEIJxUԞ-e "O-]xi"(GB#%m6m}S|,ʪC ip$%MԬi=<"H8QiiWmabFN#@|zeVAI %˶i5f{t5v] Də as`DӓUذ ?mGO;26~\!VT޻7Ui>kh$ dXTƥC-0r;E c2u}2v@t{;trwMʏAGaΩxOL\WOcW|\ՁgT_֪a+ xۇt|ǹ1(b#ŷ|B2mR-*sv>mm?i2S2֯:@~ec@6%lY߱'{B`Xbf"8BHcI^Ǩ-&{98jrX.|F$h]:u}2k 9.}*?n 4bm "GwZ:,s4PC& d32~oh򺓢ӭkv !&-I w@Yp{oj);ovϼlj|-ZKyvٴ "(+F[!4Q Z B|ͱ8/ښGKC Hؔz"+n(x"Wfk+@mX,ȖqzXQ\ZrT @4}w\D7Yagdf)^ =t%R9GY`'WiE}5;)9,[w0˳990hb9D`O)|nþ('e>X%:NvO:Rl}Ў9ܢ nXMH:n%1|8V.iP( jwxN#D^\;%DVͯ(dJ7o{l~=7-\.61V]oqTZ@$A!~M{ƞC 67u&+6uzNdУm:Q۳QQ;e_ihܐ=+!ӅH2m%I{︁CuJME 'j8->F+3^S*t8C^.K>6?۫,#2Rҧs_.a7&X4mJAeQʍ`n¶`j1M`b6܅kBGN Ql!أ!w↾eMKw"YS1Rr9YBآ/ T"9P]i^3g^ ߰XܟKԡf`77M*ݤZ Y+VM*Ki>cXR.]YuŶ~;i3yFFXn |P5TF8'OG1dg{ɱ3IjmRdsЙ$Z5) . =á"}Wog;:MOȿb{7 Z'+=yF1juƿ*(zG qkeH+#. G9!}DS;wH$ܚΚ/%r;Kw}P]2xqv@pZ@y}o-07~&rWIKlT'h':H_9uH`;/fk, VY-,e"*'ƭɬo뚈pyxb @бg-Ỹz$1 Qq3 CFc6MkP=`ㅩFO#aONȥ#[7X5~Y-GFȄ?(a ׆h:DŽu+QW3Tus9ȷ^jU x;]cmچAΡgZ:8NJ^[gPQU:htG/S{x~eRS%$>-U>օ%l.A֖UtH eUO 8OvvΝ6ΜL\جFVM_?$-ʑt[F^[;x^^1Lm}eatnq{BJgy(I7 Tb3~8%-Oj s=Wو,p:\cx fJ-nURӐS%͙ &"1 +̿vrѹ +YN&hk-w@!(n557ދzN_0 VJnڙy wCW՟C2CEOVVöy0^  BSQN0#3~]sd!|'Nj5۵ZOQ5>fOrdiiٗ|L}6c#k_&RuAy^ 0sZx )lrZ#HD0zmҙ`Qt{p&,F%)@FN)sӊ/p]?' ~']UMОso6a62MB0=$-2l7:(C׬ p2ZT@!-K@Vk[Qv@?@̵Zܱ o b|0XMDSq̍Q>hB?dE\j?9_KB%$"e’Thʡ0!"qox986EܪT]mJe69 *q9/d2Q ;!f[0*$~-~bs](4D5ܞVP>$#xo[|D=OsvMzu ?:殙'Y*6% ܄TomVVAQ~#MBY1FBUbXaA/.V*== %q,dt>74AxVAJZ;2-Vss[@_%MbMx$3ǂ,=UhCUˀiCuR:!ZpB۝rMϜX Aڧ~(6rE=#V >@yůW?@vt FNof!0;ײFli!y(άc` fkx//{q 2?jLFcRf?4 +]ĭAkRdmׄON(Q$0Y0%ȇc9cJӞ޹EupYuA++,ϱx$i(ZQSnyM_06ׂztS}Jt:8 9P]c 5E3σ_DucόIɟf|27ʠ!Z%hZ& :?_vU4ˠaoEqL߂sCL'ň9QZm9p=7C!F#`Ԯ/,x5; '*/(QU^Q|gxX;RQB <1XdQm=IqK "4ՄM~s[A`@l@C]&@<ؐȹ4/F 3._P@b^ْiM0arYm!~u:Y d :l dZyzԽ VYlp)0:;xݥmQkO$S\,ݟnZETo`/g""箖CiCQj]񭤇jqK4v]Q0%DL:$)fF#j#A2c"ʷH̓>{|\/1:A8woץC촮iG g⮽JcR h" rmEսГPVF^^Z~; [)Kbd7ZqZTpnj~R1TfGk- Z3 , (v}:}ȼ$swGQec3?e}Ö@d9/ZP>{I50ɂX!`'j+P[b(/Y]t:.̘c3q;[_۞nUbOZn3 5΅y ֍&ς'}ʬsqFѮ SZ|'::ޫC/{3;Qm"B\0sIc"ӎtbC 2&CړkO5O iɒ]d-A@Qo#MtL[%H^r%AºlP>rS0La偙L=t7k ̖r _x̼'3$ 1@|2)O}l)JB7< 8r&ؾWTֹJMO>\-;DʨܣaY|B޽hEA+fѫI觇 px<7.!d[)Woos!c!uʩ/\Khp[3[ Uw> <^h)VR<E sdEܷj(I [OI K5.: ӌ>^T>`iM@<9Q;eBt Lh -":<<7Uy8l DVB悯V~rR iT-!2=ܝ.(ۯZ4] /y6#D?Dx_m2c@)"X`ě{Y!IB:.6Ict(F [8 z{6UݪM-Nk)։6D/DjDz aB q s|(A3LF^/W!1DJv%$OA4!OٹBmE^-ȴզb?dWkjf[ٟ?Zjw[c>8}<#Q7wsߛkO6} aj*rjO9HZ[y,_:"טDԏ \{ՒkuCsgs9/YŰqtW#(C Tt [ɚX<ĉ8Z}prE-KdJ Oy)ZX7s3u`Q>~ ̤ԙK5gAc>D^vkle'ߌ(V|G  u#r fnn; u"u:r\/{L6|s.Bˀ=!QVOyƪqLILJ{Ox* lYW'vNx,AI(ec10>?:8Hi:; *Gfj]a;Qԅ.jSvyr8I 㣹ho/E2{jTZh%6// G*9F8)=>vتU|5b*$H1Z޼S6Ui1Ce!u18䫍㺠Ry)WFP:?8HdkE6`""Br5S; n> /W-clt0jkc-2D| )J٠d{xe׺? g3E9 (be1h%VSBPI!dix"XPP;3.MؕP3R4CL? e> xZ;e"9mh+{B5Q-tn,fex!R]:1d܂)H-L(>Ns{G5{1nJpSܻg沖x L ͉ Ē¦R$-)v:f7RgV*m*xX|) *>2r"vzcntfFPsS?5h- !Oiot,-12p |3O[u )zuV2cOZyƳw(Yé-su@2p;Tpqw^`dIIW5lV=:I)Uܻ?&L2HRIBdQ.Cnj/} M/(N2!CAgܐ'P/"MmA;Ԋq$$ Aոy]OGލ'k{u7Q  FYβrbOZ":l^]!)zep *+WZδJx1#۶uh$dMb1q}E ? ,~k&Auq4 C`DžQbX lz:=zbeC[nvT•%ܕOUed~b3&f,ZoxFm ('#|%9V_M)!pi1[{YP\)QD0V(fa*Ju޵BhIÒ, ̰͗lyj<gm(D%vRXFzAa;;t3NPl8Ȳ/&A"08PbbX͔i7M JnQaT5 f(:U'/=ƽe]J[޳.6%[v`˟å^ 1 =l̿ydb xyml虊Θcz1fda(o㹗5-d5>a6~+P!_Q_n;31)֛YBI]s|d 8"fb9>JP$gu= i*#M7M֟w\[m/7鑏N&Ɏ^ٌ&EŔi%?.0҂d 6D}|krr~!iC[9VZ(/߂5A"w@mTe|Ux5}ۻG|r:|ƻ.8Ȟ4&wI=GdR5`_jx<ިPaOZJXu5d*:??V=7=/?"z4Eb yO?m5fܳM߿(GoH*0P H҄z%4z4ZOĖzۮgaCӘbCZ,iH@HAew%wG$B>iNwrN輸u[spۚfςɯA{>v'C7SN ȼG6>NO?'Ȯ3kzB@^ e)nZǡO'퍝l\x鬵MBO}^~I|jK:Nx1cfXJ}jfH*a7nben!9LԞśs>˯BPG&fPAdCt9[i!>iX~Fq%ҼMZ9ʖJ 'ǛcS<8 +ih2zT_d 98f1Z .'_;Ӊ\k(ZÉ[u+BîT-,#4՚Un`>*r{qiwU "WU B˒2F4$uXx9S1#qmЁ[A:T՝U evKf$\[aX:I(yH}.~{LQJӀ*3O;:溆⍗UÂWM+"n}Gm+,Ϭ4[hD鶏O׵=qB]ٲ-hqfT%j_G(ء|k(nN"^ Y+[.\:t )IVLY)^ ?bWͺ܇">nã{{Az:КRTYAYX>r镀%zǎL"w/ʋf5SB]cv5\1un ѷRq}TaRoh)5n ҇Mwݥ# ].kexGı41c$DPy!E hp/G2Bΰڿ/|g2X50UnWe(*=^}a "{8 ;~]NE1bhUcIH%<[q6kj`Kfȅw2%"F$r_ E(7zh6IKpP4a`iF\ @|5;WLWP$#ᠾ$Fjgt$gi3 2_&c*!ٷaһ C,:`w՞5nXyp|$Pޅ)&!dMewBS6i(a(l.͍m= b] {Gq#.H`PiN>?fZQWat-_bwڍr ʘ z"L)`L(Ɩ,bmy\ w&Z"Q \9`I9Uc[q"nJ,0{ a$jvAMJP_( 6k94@m˙ddzg( jL{c1{SnQgH,~|'ssp *1#ۧE,XL >:[sSR%P} % lHs|[2E=uD[8GO6Ɲ<%_bVcn8;LHɴ iƿߟ`h Gd%?2jS7-oGS$$\R&}ͭE>FgO bW^ $6SSg<@>Zul)v]2N^|!pud= 7DR$__G7Ԍͅ:L;qL<3=\tMbN:=M. I9" Dbu$7͜Ǵ$?ZB_cV : d"G=1#aCpEo.*sW_#-,<~o޶R t8 h"pslW3* G7Bmv~wˋ8~|.5b!PގIJ5`o=ZzoDz&AV o=kYkc(7e?2R3/,k@P-* `_ub*gX)tkB߷ f{v]2uˡMşoq_V}ә.~ד# ]-Ks3򥺑.Zkug`{~b*If#`T;XXV"=9{=a͙ʦꮍ4Rڠ-W6TWeWԫ_V=ӇQ\ ݉rǁ_;g#G0vեCǞf/Mg[&h궁 s?QgRKDI Az66 2`&e5VkxՋMC/dsqsڮn9逩ne(maw1˰){].XM%F45KR?%d D© E`5Sz6m.FP_iM+fBr,ku)$`•4R4}#ǾBå%HRHL+F"K_jEl'¥UT nB2ΞdOb5"3Ofr4><2HuνPkyyݖP%MGLx_[: ޛVl'I%`I}c.i~1:ho8͢?*)=4Q_r@f=q#Kh1umx}Ї B_ncU<ڡM_Qʱ 6]vdzrr׎9惪,7\[l|.!F]LD .A|4S ˯[hmUr&4?v;O*{\h3S+rفi(\B5b2<Xe !Y;+꣰G#SUk.6q<zcz[T W'%̗p?pojCڹp{e84 Eٚt$.]ȵ^t-s ^Oz{ 9s"_[`y9`,>lp֚f'i :&Uϴ)2T^j>j'ٔwPNv,.Ԍ2b<d$JwE0k6H/R{DoOmJWCP2\@ +k{5Ղ"=;8 FGoǽeaHl~P9V/,iq:UVPqn]Ы2\l.=KӅQp畛M{ `9)NaxBYn]y:ք-+GD@3! *UK%.!q4\#*٧=cYH^w`hoC3:z<`cH#+HG!0ó14YTWՀz(F6v=1dk8|H%A rmGj{UF-Ί V|fdQobFaިd) FLEHʐͼ[C l"nw:qҡk҉5Խh.R/.DZqOtسzx5i"m_ C>&=wT6$bg[]9Ansl+}߈盚輾9dA('&3BDSzY"V_1:^km捖h7XB ' s#aZ5G@qv{˭o?DQ ][bc?F'"2i{:17($F-CO5m*hHno]Qڣ9P512wX5k+gw;wm 3L^@Ռkg"hBowPǞL`Q窅jOI0hՒbvD>?5p`ݯdCjǺOFmBK_FY  z^ke$+r;7eȶ|?kH}nosgaQÁXS$8qn1(ޖMgFVb>,zS;^w+#L? βZhռvOTW24QI&7%Ni׾>-l>b- :#K{?F^*s7J/7=Jy^q "A m^<쨙ΕO?J,j*x0dm`/)ᒔ6T4cyEy gвs8?iCt A5ǛOBN3HIxXG$4aeFnv=L)s^m$+t Z &: ]K?+ `hBuG#P<ثONӳ ])Rw{.%`FI[Ԋ-!Hs s5A !G񫇋戮{qJ /S W5z%\r2Y5֑)G;*"xa}"Y-"uԻ,U]Rc]/aZlIR 9䊑dqh6wG9ER]B#aOeرNA .`fĄfgqȍdEqwG(Ukh/P,zGSgl-;Jv"K ~Ul!By"Qm'4E`ծYd,F KGV")kڃTŹ;)I@EzPj$@@!bBIE~UK[Ov"Ցd-rY~hbbHmnޤʇCU8VMݲsɵJmzGL&sj瓐 KDUpAwTN$Q@slcx3S%5$K`[f;2uf Fqtl~Wvn&->>ڃݡK lϝ.15 47JVH>e Ru 7w[D3Z%N驏yÖSKcQM0Jj8 Ƿ1g:'V4oM}qBh@D eQаϻR_燫~{ e<QWgO\)2K׾NtSaYhzsu45mŵӐū6߮'UA?50 pMiY}_O:0ǀеncbݲZ;hQ5|< ]O87UXl'GyG&]p<ϣmGc+5v)1H QðJA^NРz2 A%݄zdk( /&e.Z1 [iN;rˣJ_ ~פַQkMg37bp;p6!kֵ3}L6uvmSYS8)#=a좽} Gƅ f\ \T(o!%vp7k%8AFJ{fh.-)jQ@2v$b]QFySmNyE+;J爨asNA(ݠyG][棁ܾq7.g!tťm%4ϳ ">3AdB] 4]WadA$KB>T-zPH|˟͉ܓGPf.# yv ZexY^(5. @J.Iշ `* ĉ"fH0C_ M|>T}$ʹblʀ|ҼŬj=^pʼt;a9 Lk!Z8 bۚ&jDzɹZ`pQigwN Ozp33UB~$NMX#@s =3bhI%B! <6Svfo1]9E FrL P᎒9iQąEzѼCxTQ[)-3зk?|3Frw;6%[QI@TfS;4j篔u*SJ5O hT&tlL9Ӱ0k%7B rM+~A!a M:ɠYB?lAyVo?>jg7Q^܇#H% `8] .`_!9%ʰIF^ 5;4۪dDScw:O]<.dP4.^+D-CB)Uƌ+YWDZB%Mk/8خrqSV-&Kxdl#3EZkbk.WG]N@~K"u &TQAOY`<xf1ŪBgPXa4Q>m[B1wnfokXFf>c`}uStm6и!"=u:"}Y'3u?>bN?ǭtF/rG㦬&0O#f`A5:Κt:cL`md* #| hH1) @v~kNJ-mU%0pH<)mjzqdx?F$A ݥ|,]J 24+_ f*/Cz Jxv!~noSDE<?\C1ub:+䆙#0v,6ٻL~ģ7}Şˡɿr`]~6Alk;YAp# qw( ~FT0g,ZLi2a]&@+wr%"m֪?.{F7t2q$2 Bb`,qٽn.Al==a皎Gx)Cocp3zc U'+`]54P2.nXr(s96:`ʩw5QےSֵ YZ